KEGG   Orcinus orca (killer whale): 101278197Help
Entry
101278197         CDS       T05247                                 

Gene name
CDK15
Definition
(RefSeq) cyclin-dependent kinase 15 isoform X2
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101278197 (CDK15)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101278197 (CDK15)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101278197 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 101278197
NCBI-ProteinID: XP_004262894
Position
Unknown
AA seq 468 aa AA seqDB search
MGQELCAKTLQPGCSCHCCWEGGDAHSRQRSAPVMMEAAIKLTDLKEASCSMTSFHPRGL
QAVRARKFKSKRPRSNSDSFQEEDLSQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKV
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDNWPGVSKLPNYNPEWFPLPKPQSLQNVCNRLDRAPEA
EDLASQMLKGFPRDRVSAQDALVHNYFRALPAQLHQLPDAQSSYNNYAVRFRKLMRSQQM
EGFAFVRCCRRTTRLLFSFFLFFPLVFFFFFCELGRRVGQSMAKLKSL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagagctgtgtgcaaagactctgcagcctggatgcagctgccattgctgttgg
gagggaggagatgcacacagccgtcagaggagtgctccggtgatgatggaggctgcgatc
aagctaacagacctaaaagaagcatcatgttccatgacttcatttcaccccaggggactt
caggctgtccgtgcccggaagttcaagagtaaaaggccacggagtaacagcgattctttt
caggaagaggatctgagtcagggttttcagtggaggaagagcctcccctttggggcagcc
tcatcttacttgaacttggagaagctgggtgaaggttcttacgctacagtttacaagggg
attagccggataaatggacaactagtggctttaaaagtcatcagcatgaatgcagaggaa
ggagtcccatttacagccatccgggaagcttctctcctgaagggtttgaaacatgccaat
attgtgctgctccatgacattatccacaccaaagagacactgacattcgtttttgaatac
atgcacacagacctggctcagtatatgtctcagcatccaggagggcttcatcctcacaat
gtcaggcttttcatgtttcaacttttgcggggcctggcgtacatccaccaccaacacgtt
ctccacagggacctgaaacctcagaacttactcatcagtcacctgggagaactcaaagtg
gctgattttggtcttgctcgggccaagtccattcccagccagacatactcttcagaagtt
gtgactctctggtaccgccctcctgatgccttgctgggagccactgaatattcctctgaa
ctggacatatggggtgcaggctgcatctttattgaaatgttccagggtcaacccttgttt
cctggggtttccaacatccttgaacagctggagaagatctgggaggtgctgggagtccct
acagaggataactggcctggagtttccaagctacctaactacaatccagaatggttccca
ctgcctaagcctcagagccttcagaatgtctgcaaccggttagacagggctccggaagct
gaagacctggcctcccaaatgctgaaaggctttccaagagaccgtgtctccgcccaggac
gcactggttcacaattatttcagggccctgcctgctcagctgcaccaacttcctgatgcg
caaagcagctacaataattatgctgtcagattcagaaagctaatgaggagtcagcaaatg
gagggttttgcatttgtgagatgctgcaggagaaccactcggctgcttttttccttcttt
cttttttttcctcttgttttctttttctttttctgtgagttgggaaggagagtcgggcag
tccatggccaaattgaaatccctttga

DBGET integrated database retrieval system