KEGG   Orcinus orca (killer whale): 101278411Help
Entry
101278411         CDS       T05247                                 

Gene name
CPT2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00071  Fatty acid degradation
oor01212  Fatty acid metabolism
oor03320  PPAR signaling pathway
oor04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101278411 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101278411 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101278411 (CPT2)
Enzymes [BR:oor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101278411 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 101278411
NCBI-ProteinID: XP_004273886
Position
Unknown
AA seq 658 aa AA seqDB search
MVAGLLLRAWPRGLAFGPGALSRLLSTGFDPGQYLQLSIVPTMHYQDSLPRLPIPKLEDT
VRRYLSAQKPLLDDGQFRKTEQLCKSFENGIGKELHKQLVAQDKQNKHTSYISGPWFDMY
LTARDPVVLNFNPFMSFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRADLLEPEVFHLNP
AKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGHFYVFDVLDQNGNIVSASEIQAHLKYILSDSSLAPEFPLSYLTSENRDIWA
ELRQKLVSGGNEETLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGTAAIHFEHAWGDGVAVLRFFNEVFKDSTQAPAITPRSQPANTDSSVAVQKLNFKLN
DALKTGISAAKEKFDATMKTLTIDYIQFQRGGKEFLKKQKLSPDSVAQLAFQMALLQQYG
QTVGTYESCSTAAFKHGRTETIRPASIFTKRCSEAFVREPSKHSAGELQQMIAKCSTYHN
QLTKEAAMGQGFDRHLFALRYLGAAKGIDLPELYLDPAYRQINHNILSTSTLSSPAVNIG
GFAPVVPDGFGIAYAVHDNWIGCNVSAYQGRNAHEFLQCVEKALEDMFDALEGKAIKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtggccggcctgttgctgcgcgcctggccccggggccttgcctttggcccgggagcc
ctcagtcggctcctaagcacaggcttcgacccgggccagtacctgcagctgagcatcgtg
cccactatgcactaccaggacagtctgcccaggctgcctattcccaaacttgaagacacc
gtgaggagatacctcagtgcgcagaagcctctcttggatgatggccagttcaggaaaacg
gaacaattgtgtaagagttttgaaaatggtattggaaaagaactgcacaagcagctggtc
gctcaggacaagcagaataaacatacgagctacatttcaggtccctggtttgatatgtac
ttaactgctcgagacccagttgtcctgaactttaatccatttatgtcattcaaccctgac
ccaaagtccgagtacaacgaccagctcacccgggcaaccaacatgactgtctctgccatc
cggtttctgaagacacttcgggctgaccttttggaaccagaagtgttccacttgaaccct
gccaaaagtgacactgataccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtatggcgcctacttggtcaatgcataccccctggatatgtcccagtattttcggctt
ttcaattccactcgtttacccaaacccagtcgagatgaactcttcactgatgacaaggcc
agacacctcctggtcctaagaaaaggacacttctatgtctttgatgtcctggatcaaaat
gggaacattgtgagcgcctcagaaatccaggctcatctgaagtacattctctcagacagt
agcctggcccccgagtttccactgtcatatctgaccagtgagaaccgggacatctgggca
gagctcagacagaagctggtgagtggtggcaacgaggagaccctgaggaaagtggactct
gctgtattctgtctctgcctagatgacttccccattaaggaccttgtccacttgtcccac
aacatgctgcatggtgacggcacaaaccgctggtttgataaatcctttaacctcattata
gccaaggatggcactgctgctatccactttgagcatgcttggggcgatggtgttgcagtg
ctcaggtttttcaatgaagtgtttaaagacagcactcaggcccctgctatcactccacgg
agccagccagctaacactgactcttctgtcgccgtacaaaaactcaacttcaagctgaat
gatgctttaaagactggcattagcgctgctaaggaaaaatttgatgccaccatgaaaacc
ctcaccattgactacatccagtttcagagaggaggcaaagaattcctgaagaagcagaag
ctgagccctgattcggtggctcagctggccttccagatggccctcctgcaacagtacggg
cagacagtgggcacctatgagtcctgtagcactgcagcattcaagcacggccgcaccgag
accatccgcccggcctccatcttcacaaagaggtgctctgaggcctttgtcagggagccc
tccaagcacagcgctggagagcttcagcagatgatagccaagtgctccacgtaccacaac
cagctgaccaaagaagcagcgatgggccagggctttgatcgacacttgtttgctctgcgg
tacctgggagcagccaaagggattgacctgcccgagctatacctggaccctgcgtatagg
cagataaaccacaacatcctgtccacgagcacgttgagcagcccagcagtgaacatcggc
ggctttgcccccgtggtccctgatggttttggcattgcgtatgctgttcatgacaactgg
ataggctgcaacgtctctgcctaccaaggccgcaatgcccacgagtttctccagtgtgtg
gagaaggccttagaagacatgtttgatgccttagaaggcaaagccatcaaatcttaa

DBGET integrated database retrieval system