KEGG   Orcinus orca (killer whale): 101279119Help
Entry
101279119         CDS       T05247                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04260  Cardiac muscle contraction
oor04261  Adrenergic signaling in cardiomyocytes
oor04921  Oxytocin signaling pathway
oor05410  Hypertrophic cardiomyopathy (HCM)
oor05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
oor05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101279119 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101279119 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101279119 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    101279119 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101279119 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101279119 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    101279119 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oor04040]
    101279119 (CACNG7)
Ion channels [BR:oor04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101279119 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 101279119
NCBI-ProteinID: XP_004285738
Position
Unknown
AA seq 278 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDFFLNRPSSSEQYFHYRYFFSFA
FAASSFLLKEGFFVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCFFYSGQFLQPEAWRRG
RFFSDISSDVSIQMTQNFFLAIKYPDHLHISTSTLRTR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagtagccgcgccctgaccctgctgagcagcgtgtttggtgcgtgtggc
ctgctgcttgtgggcattgcggtcagcacggactactggctgtacatggaagagggaacg
gtgttgccacagaaccagaccacggaggtcaagatggcgctgcatgccggcctatggcgc
gtctgcttcttcgcaggccgggaaaagggtcgctgcgtggcctcagaatatttccttgaa
ccggagatcaacttggtgacggaaaacacggagaatattctgaagacagtgcgcacagcc
acccccttccccatggtcagtctcttcctcgtgttcaccgccttcgtcatcagcaacatc
ggccacatccgcccacagaggaccattctggccttcgtttctggcatcttcttcatccta
tcgggcctctccttggtggtgggcttggttctttacatttccagcatcaacgactttttt
ttgaacaggcccagcagctctgagcagtatttccactatcgctattttttttcttttgcc
ttcgcagcttcctccttcctactcaaagagggtttttttgtgatgtccgtgtacctgttc
accaagcgctacgcggaggaggagatgtaccgtccgcacccggccttctaccgcccgcgt
ctcagcgactgctttttttactcgggccagtttctgcagcccgaggcgtggcgccgcggc
cgttttttttccgacatctctagcgacgtatccatccagatgacgcagaactttttttta
gccatcaagtacccggaccacctgcacatctccacctcgacgctgcgcacgcgttag

DBGET integrated database retrieval system