KEGG   Orcinus orca (killer whale): 101279924
Entry
101279924         CDS       T05247                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04080  Neuroactive ligand-receptor interaction
oor04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101279924 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101279924 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101279924
NCBI-ProteinID: XP_004280577
Position
Unknown
AA seq 77 aa
MNLRLCVQALLLLWLSLSAVCGGPLLQTSDGKGMEEGTIRHLVQPRGPRSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgagcgcggtg
tgtggagggcccctgctgcagacttctgacgggaaggggatggaggaaggcaccatccgc
cacctggtgcagcccagagggccgaggagcggcccagggccctggcagggaggtcggagg
aagttccgccgccagcggccgcgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system