KEGG   Orcinus orca (killer whale): 101281269
Entry
101281269         CDS       T05247                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oor03021]
    101281269 (AFF3)
Transcription machinery [BR:oor03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101281269 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101281269
NCBI-ProteinID: XP_004277798
Position
Unknown
AA seq 1245 aa
MDSFDLALLQEWDLESLWGEDILNQRSDSLVVEFQSSASRCRSVYEPDRNVLRRKERERR
NQETQQDDGAFNSSYSLFSEPYKTNKGDELSNRLQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQAPVNKIDEHFVADLRAQTQPASVCSTTSSAPAVVPGQQSKRGTVGWQKAGHPP
SDGQQRATQQGSLRTLLGDGVGRQQPRTKQVCNVEVGLQTQDRPPAMGAKHSGSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPNESPKLKSSTETSVHCASYRGASAAKPEPA
RTKAKLAKFSIPKQGEDSRSGETNSCVEEIIREMTWLPPLSAIPAPGKVEPSKFPFPNKD
SQLTSSGHSNPKKGDAEPGSPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALHALSDS
AGLPQADCRASVPSSKGSSSGSSSSGSSSSSDSESSSGSDSETESSSSESEGSKPPHYSS
PEAEPASSNKWQLDKWLNKVNPHKPPILIHNESHGPESNQYYTPVKDEAPDCGKLPDNVC
PTSLRDKDIKSACKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVTAAAPPPTVAGAPAES
APAPARRSAGKKPTRRTERTSAGDNGHRPEEPAAADALGASAGIPPEPPKPRPCGNSRTS
HRKELRSAVTGEKRRTRGLSRIVPKSKEFIETESSSSSSSADSDLESEQEDYPLSKATAA
SGNDPRLKEAASSISGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDS
DEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPAAKDTESAPPSHASDAPAEKALPKSKRK
RKCDSEDDCREIRKAQGEKESSSRLTASASSTLAANHCNVNVNSLAIPINKNEKMLRSPT
SPLSDASKHKYPGEDLTSPSRSNSNGLFTSASSSKKHKAENQLQTHGGDLTKAAHSNSEN
VLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAMVEKFGKA
LNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLA
ALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMS
PNPSPTSSVGSQGSLSNGNALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNL
AKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLT
NT seq 3738 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaaaccagaggagtgactccctagttgtggaatttcagtcgtcagccagcaga
tgcaggagtgtctatgaaccagatagaaatgtgttacggaggaaagaacgagaaagaaga
aatcaggaaactcagcaggatgatggcgcgtttaattcaagttactccctctttagtgaa
ccctacaagacgaacaagggggatgagctctccaaccggctccagaacactttaggcaat
tacgatgaaatgaaagactttctaacggatagatcgaatcagagtcatctcgttggcgtt
cccaagcctggggttcctcaggctcccgtgaacaagattgacgagcattttgttgcagat
ttgagagcccagacccagcctgcatccgtctgcagcaccacatcctccgccccagcagtg
gtccctgggcagcagagtaagaggggcaccgtgggctggcagaaggccgggcacccaccg
tccgatggccaacagagagcaacacaacagggctctctcaggaccttgctcggagatggt
gttggcagacagcagccgcggaccaaacaggtgtgcaacgtcgaggtgggtcttcagacc
caggacaggccacctgctatgggagccaagcacagcggcagtggccactgtgttcagaac
tttcctccatccctggcttcaaagcctagcctcgtccagcagaaaccaactgcctacgtg
cggccgatggatggccaggaccaggctcccaacgagtctccgaagctgaagtcgtccacg
gagaccagcgtgcactgcgcgtcctacaggggagcctcagccgccaagccggagcccgcc
agaaccaaggccaagctcgccaagttcagcatccccaagcagggagaggacagtagatct
ggagaaaccaacagctgtgttgaagaaataattcgggagatgacctggcttccaccactt
tcagctattccagcgcctggaaaagtggaaccgagcaaatttccatttccaaataaggac
tctcagctcacttcctcgggacacagtaatccaaagaaaggtgatgctgagccagggagt
ccagacaatggcacatcgaatacatcaatgctagaagatgaccttaagctaagtagcgat
gaagaggagaatgaacagcaggcagcccagagaacggctctccacgctctgtctgacagt
gccggcctcccgcaggccgactgcagggcctccgtgccctccagcaagggcagcagcagc
ggcagcagcagcagcggcagcagttcctccagcgactcggagagcagctcgggatctgac
tcagagaccgagagcagctccagcgagagtgagggcagcaaacccccccactactccagc
cctgaggccgaaccagcgtcctctaacaagtggcagctggataaatggctaaacaaagtt
aatccccacaagcctcctatcctgatccacaatgaaagccacgggcccgagagcaatcaa
tactacaccccggtgaaggacgaagcgcccgactgcgggaagcttcccgacaacgtctgc
ccgaccagcctgagagacaaggacatcaagagcgcctgcaaggaggagcagaggccgagg
acagcgaacaaggccccggggagcaaaggggtgaagcagaagtccccgcccgcggccgtg
gccgtggccgtgaccgccgccgccccgccgcccacggtggccggtgcgcccgccgagagc
gcgcccgcgcctgcccggaggtccgcgggcaagaaacccacgcggcgcaccgagaggacc
tccgccggcgacaatggccaccggcccgaggagcccgcagccgcggacgcgctgggggcg
agcgcggggatccccccggagccccccaagccccggccctgcggcaacagtaggaccagc
caccgcaaggagctgcgctcggccgtaaccggcgagaagcgccgcacgcgggggctgagc
cggatcgtccccaaatccaaggagttcatcgagaccgagtcgtcctcgtcgtcctcctcc
gcggactcggacctggagtcggagcaagaggactaccctctgtccaaggccactgccgcc
tccgggaacgacccgaggctgaaggaggctgccagcagcatcagcggtggcggcccgcgg
gcccctgtgggctctatcaacgccaggaccaccagcgacatcgccaaggagctggaagag
cagttctacacactggtccccttcggccgcaatgaacttctctccccgttgaaggacagt
gacgaggtcaggtcactctgggtcaaaattgacctgaccctcctgtccaggatcccagaa
cacctgccccaggagccgggggtcctgagcgctcccgcggccaaggacactgaaagcgcg
ccgccgagccacgcatccgatgcgcccgcagaaaaggctttgccaaaatccaagaggaaa
cgcaagtgtgacagcgaagatgactgccgggagatcaggaaggctcagggagagaaggag
agctcttcacgactcactgcctccgccagcagtactttggccgcaaaccattgcaacgtg
aacgtcaacagcttggcaatcccaataaataaaaatgaaaaaatgctccgctcacccacc
tcacccctctccgacgcatctaaacacaaataccccggcgaggacctgacttcccccagc
agatccaacagcaacggtttgttcacctccgcctcgtccagcaaaaagcataaggctgag
aaccagctgcagacccatggtggagacctcacgaaagcggctcacagcaattccgaaaac
gttctccacaagtcacggccacagacagagccatggtctccaggctccaacggccacagg
gactgcaagaggcagaaactcatcttcgatgacatgccacgcagtgcagattattttatg
caagaagctaagcgaatgaagcataaagcagatgcaatggtggaaaagtttggaaaggct
ctgaactatgctgaagcagccttgtcattcattgagtgtggaaatgcaatggagcagggc
ccaatggaatccaaatctccttatacaatgtattcagaaacagttgagctcatcagatat
gctatgagactaaaaacccactcaggccccaatgccacaccagaggataaacagctggct
gcattatgttaccgatgcctggctctcctgtactggcggatgtttcgactcaaaagggac
cacgctgtaaagtattcaaaagcacttatcgactatttcaagaattcatctaaagctgcc
caagccccatctccatggggggccagtggaaagagcactggcaccccatcccccatgtct
cccaacccctctcccaccagctccgtgggatctcaggggagcctctccaatgggaacgcc
ctgtccccatcaaccatcgtcagcatcccacagcgtatccaccagatggcagccaaccac
gtcagcatcaccaacagcattctccacagctatgactactgggagatggcggacaacctg
gccaaggagaatagagaattcttcaatgacctggacctgctcatggggccagtcaccctg
cacagcagcatggagcacctggtccagtactcccagcagggcctgcactggctgcggaac
agcacccacctgacatag

DBGET integrated database retrieval system