KEGG   Orcinus orca (killer whale): 101281498Help
Entry
101281498         CDS       T05247                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04012  ErbB signaling pathway
oor04020  Calcium signaling pathway
oor04024  cAMP signaling pathway
oor04066  HIF-1 signaling pathway
oor04114  Oocyte meiosis
oor04217  Necroptosis
oor04261  Adrenergic signaling in cardiomyocytes
oor04310  Wnt signaling pathway
oor04360  Axon guidance
oor04713  Circadian entrainment
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04728  Dopaminergic synapse
oor04740  Olfactory transduction
oor04750  Inflammatory mediator regulation of TRP channels
oor04911  Insulin secretion
oor04912  GnRH signaling pathway
oor04916  Melanogenesis
oor04921  Oxytocin signaling pathway
oor04922  Glucagon signaling pathway
oor04925  Aldosterone synthesis and secretion
oor04934  Cushing syndrome
oor04971  Gastric acid secretion
oor05031  Amphetamine addiction
oor05152  Tuberculosis
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05214  Glioma
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101281498 (CAMK2G)
   04310 Wnt signaling pathway
    101281498 (CAMK2G)
   04066 HIF-1 signaling pathway
    101281498 (CAMK2G)
   04020 Calcium signaling pathway
    101281498 (CAMK2G)
   04024 cAMP signaling pathway
    101281498 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101281498 (CAMK2G)
   04217 Necroptosis
    101281498 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101281498 (CAMK2G)
   04922 Glucagon signaling pathway
    101281498 (CAMK2G)
   04912 GnRH signaling pathway
    101281498 (CAMK2G)
   04921 Oxytocin signaling pathway
    101281498 (CAMK2G)
   04916 Melanogenesis
    101281498 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    101281498 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101281498 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    101281498 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    101281498 (CAMK2G)
   04728 Dopaminergic synapse
    101281498 (CAMK2G)
   04720 Long-term potentiation
    101281498 (CAMK2G)
   04722 Neurotrophin signaling pathway
    101281498 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    101281498 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    101281498 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    101281498 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101281498 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101281498 (CAMK2G)
   05205 Proteoglycans in cancer
    101281498 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    101281498 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    101281498 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101281498 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101281498 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101281498 (CAMK2G)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101281498 (CAMK2G)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101281498 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 101281498
NCBI-ProteinID: XP_004273142
Position
Unknown
AA seq 556 aa AA seqDB search
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTAMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSAGMQPQPSLCS
SAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENL
LSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKW
LNVHYHCSGAPAAPLQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctc
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtat
gcagcaaaaatcatcaataccaagaaattatctgcccgggatcaccagaaactagaacgt
gaggcccggatatgccgacttttgaagcatccaaacattgtacgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggtggggagctgtttgaa
gacattgtggccagagaatactacagtgaagctgatgccagccactgtatacatcagatt
ctggagagtgttaaccatatccaccagcatgacattgtccaccgggacctgaagcctgag
aacctcctgctggcaagtaaatgcaagggtgccgcagtcaagctggctgattttggccta
gccatcgaagtacagggagagcaacaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtacatcctcctggtgggctaccctcccttctgggatgaggatcagcac
aagctgtaccagcagatcaaggctggagcctatgatttcccatcaccagagtgggacacg
gtgactcctgaagccaagaacttgatcaaccagatgctgaccataaaccctgcaaagcgt
atcacagctgaccaggctctcaagcatccatgggtctgtcaacggtccacagtggcatct
atgatgcatcgtcaagagaccgtggagtgcctacgcaagttcaatgcccggagaaaactg
aagggtgccatcctcacgaccatgcttgtctccaggaacttttcagctgccaaaagccta
ttgaacaagaagtcggacggcggtgtcaagccacagagcaacaacaaaaacagtctcgta
agcccagcccaagagcccgcgcccttgcagacggccatggagccacaaaccactgtggtc
cacaacgctacagatgggatcaagggctccacagagagctgcaacactaccacagaagat
gaggacctcaaagctgccccgctccgcactgggaatggcagctcggtgcctgaaggacgg
agctcccgggacagaacagccccctctgcaggcatgcagccccagccttctctctgctcc
tcagccatgcgaaaacaggagatcattaagatcacagaacaactaattgaggccatcaac
aatggggactttgaggcctacacgaagatttgtgatccaggcctcacttcctttgagcct
gaggccctcggtaacctcgtggaagggatggatttccataagttttactttgagaatctc
ctgtccaagaacagcaagcccatccacaccaccatcctgaacccgcacgtccacgtgatt
ggagaggacgcggcttgcatcgcctacatccgccttacccagtacatcgatgggcagggc
cggcctcgcaccagccagtcagaggagacccgggtctggcaccgccgggatggcaagtgg
ctcaatgtccactatcactgttcaggggcccctgccgcaccgctgcagtga

DBGET integrated database retrieval system