KEGG   Orcinus orca (killer whale): 101281760
Entry
101281760         CDS       T05247                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101281760 (ANKRD53)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101281760 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 101281760
NCBI-ProteinID: XP_004277178
Position
Unknown
AA seq 563 aa
MSGLQDDWAAGVGWQAGRRRGRGGERDRHRDPRPKAPARSPERELEPRRAGGTPQAAAPL
RGRPHAAGGEGVSQVRRLGGPAAQKGLRARGGLARAGPAGRRCPAHSRLPPRACSSSVSL
AEVWDQRAIGSYHELFAASLGNLEWLRFCLNRHRGKIPADDKGFTAIHFAAQSGKLACLR
VLVEEYKFPADLPTNNGQTPLHLVIRSDNKTTALPCIHYLIKQGAALSTQTCNGSTPLHL
AAREGLLSCVKVLVQKGANVHAQDAMGCKPIDYCKIWNHRICARFLKDAMWKQDKKDFAH
EMGKLKRLKNQLALMEEDYLTEYQKEHQILREAAFKKWLHRKLPPQGPSPSRDTQGEPHP
PPQATVLSKTPRHGALRPPKSFYPSQEARLRQALQPSQPSVMPIPTCKQLMVRRPKVWNL
SNSPVRSPAAQIGYPQGTRLGVHPDPRPEHDFRCFLEVRSDGHGGALLRTVAGNQVAPVP
RLPLEVIIRELYPSLQPCRMKVPQGFCSVTIREVPRKRRLGDGTFWTDTLSMNLRETFDE
GFLAAVRAHQGLPTLPSPKPPPT
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtcgggtctccaggacgactgggccgcgggggtggggtggcaggctgggcggcgccgg
ggccgaggaggcgagcgggaccgacaccgcgaccctcgcccgaaagcgcccgcccgatcc
ccggagcgggagctggaacctcggcgggcgggcggcaccccgcaggcggcggcgcctctc
aggggtcgtccccatgcagctggcggagaaggtgtcagccaggtgcggcgactcggcggc
ccggcggcccagaaaggccttcgtgcacgtgggggcctggcccgcgcgggccccgcaggc
cgccgctgcccggctcactcccgccttcctccccgcgcctgctctagctccgtgagtctc
gccgaggtgtgggaccagagggcgatcgggagctaccacgagctgttcgcggcctcgttg
ggcaacctggaatggttgcggttctgtctaaatcggcaccgggggaaaatcccggccgat
gacaagggtttcactgccatccactttgcagcccagagcggcaagcttgcatgcctgcgg
gtcttggtagaggagtacaagtttcccgcggacctgcccaccaacaatggccagacacct
ctacaccttgtcatccgcagtgacaacaagaccacggccctgccctgcattcactatctg
attaagcaaggggcagccctcagcactcagacatgcaacggctccacacccctgcacctg
gcagcccgcgagggcctgctgagctgtgtgaaggtcctggtgcagaaaggtgccaatgtt
catgcccaagatgccatgggctgcaagcccatcgactactgcaaaatatggaaccaccgc
atctgtgcccggttcttgaaggatgccatgtggaaacaggacaagaaggactttgcccat
gagatggggaaactgaagaggctcaagaaccagctggccctcatggaggaggactacctg
actgagtatcaaaaagagcaccaaattctgagagaagctgctttcaagaagtggctccat
cgcaagctgccgccccaaggcccatcccccagccgcgacactcagggagagccccatcct
ccaccccaggccaccgtgctctccaagacccccaggcacggggcactgcggcctcccaag
agcttctacccctcccaagaggcgcgcctgcggcaggcactgcagcccagtcagccctcg
gtgatgcctatacccacctgcaagcagctcatggtcaggcggcccaaggtgtggaatctc
agcaacagccctgtcaggtcccccgccgcccagattggctacccgcagggcacccgcctg
ggcgtgcatcccgaccccaggccggagcacgacttccgctgcttcctcgaggtgaggtcc
gacgggcacggcggtgcgctcctgcgcacagtggccggcaaccaggtggcgcctgtgccc
cggctgcctttagaggtgataatccgtgagctgtacccgtcgctgcagccgtgcaggatg
aaggtaccccagggcttctgttctgtcaccataagagaggtgccccggaagcggcgcctg
ggcgatggcaccttctggaccgacactctgagcatgaacctgcgagagacgtttgacgaa
ggcttcctggcagccgtgcgagcccatcaagggctccccactctgccctcccccaaacca
ccccccacttaa

DBGET integrated database retrieval system