KEGG   Orcinus orca (killer whale): 101281877
Entry
101281877         CDS       T05247                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oor01002]
    101281877 (ADAMTS13)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101281877 (ADAMTS13)
Peptidases and inhibitors [BR:oor01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101281877 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin TSP1_CCN Reprolysin_5 ADAM_spacer1 Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 101281877
NCBI-ProteinID: XP_004285100
Position
Unknown
AA seq 1497 aa
MSKLRLQGRCVRAILISVPLILLGCWGLPDFRQQFLQALEPEEVTAYFGPDVASEVPRFD
VAPLTCVCEPEHEAEDGRGGLPCRAPSCSLAALGRLFWASLPPXFTSERVVNASLRLLGA
PHPCLAGGLALLPPDAASRLTFCLGCVEGDILVGADGFYIQPLRRWHRELVPPWGGAQPH
LLHRPAPRAPTVPGTAPGRGRVELSRPITPSPGRPPAPRPRRQAVRSLLHLELLVAVGPD
VHRAHREDTERYVLTNLNMGSELLRDPSLGAQFRVHLVKTVILTQPEDAPNITANITASL
LSVCEWSRTVNPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGVCSPSWSCLII
EDTGFDLGVTIAHEIGHSFGLEHDGAPGSGCGPSGHVMASDGAAPARGGPAWSPCSRRQL
LSLLSAGRARCVWDSPGPQSQPAGRPSEAHPGLYYGADEQCRVAFGPTAVACTFRREHLD
MCQALSCHTDPLDQSSCSRLLIPVLDGTECGVGKWCSKGHCRSLAELAPVGAVHGHWSSW
GPASPCSRSCGGGVVTRRRQCNNPRPAFGGRACVGADLQAEMCDSQACEKTQLEFMSEQC
AQTNGEPLRLSPGSTSFYRWGTAEQYSRGDALCRYLCRAIGESFIVRRGDSFLDGTRCVP
SSPQEDGTLSLCVSGSCKTFGCDGRMASGQVRDVCQVCGGDNSTCRPQNGSFTAGRAREY
VTFLTVTPNLTSIYVINHRPLFTHLAVRIRGRYVVAGNASISPSTTYPSLLEDSRIQYKV
TLTEDRLPRLEEIRIQGPTQDDMEIQVYRRYGEEYGSLARPDITFTYFQPKRRPAWAWAP
VRGACSVSCGAGLRWVTHSCRDQAANEWVEAARCAGSRQPAAWSESCTSVPCPPSQEMPD
ACSSACGTDPAVQNTTCVQGADGMGAPATAGPCSADEKPPALEPCIEVSCPPGWGHSDAP
SPGENAASPAGSARPEAHATHVWTPLAGPCSVSCGQGLMELRFVCMDSALGTPVREELCD
LASKPGGRREVCQAAPCPAWWRYQLAACSVTCGGGVAQRILYCARAHGEDKAEEILPDTQ
CQGLPRPEQQEACSPEPCPPRWKVMFLGPCSASCGLGTAMRLVACVQLDQGQDTEVDGAA
CVGLVRPQASIPCIIADCTYRWHVSAWMQCSVSCGDGIQRRHDACLGPQARVPVPADFCQ
HLPKPVTVRGCWAGPCAGQGTPSPVPHEESTAPGQTTAATASPRWPQPQAHLLSPAARPQ
GRPPGPQESPAESSTCGRQHLEPTGTIDMRGPARADCAVAIGRPLGEVVTLRVLDSSLNC
SAGEMLLLWGRLTWRKMCGKLPGMTFSSKANTLVVRQRLVQLRGGVLLRYSSQPAPGAFH
RGCDMQLFGPRGEIVSPSLSPDGRNMGGCRIFIDVAPQARIAIRALAMDTGTRTEETDSS
YILIRDIHSLRTTTFRGQQTLYWESEGSQAEMEFSQGFLEAHTSLRGQYWTLQARAH
NT seq 4494 nt   +upstreamnt  +downstreamnt
atgagtaagcttcgcctccaggggagatgtgtgcgggcaattctcatctctgtgcccctc
atcctcctgggctgctggggactccctgatttccggcagcagtttcttcaggctttggag
ccagaggaagtgaccgcttactttggccctgatgttgcctccgaagtgccccgattcgac
gtggccccgctcacctgcgtctgtgagcccgagcatgaggccgaggacgggcgcgggggg
ctgccctgcagggccccgagctgctctctggcagccctgggacggctcttctgggcctcc
ttgccacctnccttcaccagtgagcgtgtggtcaatgcctccctccggctgctgggggcc
ccccacccctgcctcgcgggaggcctcgccctgctgcccccagacgcagcgtccaggctc
accttctgcttgggctgtgtggagggcgacatcctggtgggtgcagacggattctatatc
cagccgttgaggaggtggcaccgggagctggtgcctccctggggtggtgcccagccccac
ctgctccacaggcccgcccccagggcacctacggttccaggtacagctcctgggagaggg
agggtggagctgtcacgcccgatcacgccttccccaggccgtcctcccgcccctcgcccg
cggagacaggctgtcaggagcctcctgcacctggagctgctggtggccgtgggccccgac
gtgcaccgggctcaccgggaggacacggagcgctacgtgctcaccaacctcaacatgggg
tcagagctgcttagggacccatccctgggagctcagttccgagtgcacctggtgaagacg
gtcatcctgacgcagcccgaggatgctccgaatatcacagccaacatcaccgcatccctg
ctgagcgtctgtgagtggagcaggacggtcaaccctgaggatgacacggatcccggccat
gctgacctggtcctctacatcaccaggtttgacctggaattgcctgatgggaaccggcag
gttcggggggtcacccagctgggtggcgtctgctccccctcctggagctgccttatcatt
gaggataccggcttcgatctgggggtcaccatcgcccatgagattgggcacagcttcggc
ctggagcacgacggcgcgccgggcagcggctgcgggcccagcggccacgtgatggcttcc
gacggcgccgcgcccgcccgcgggggcccggcgtggtccccctgcagccgccggcagctg
ctgagcctgctcagcgcaggacgggcgcgctgcgtgtgggactcgccggggccgcagtcc
cagcccgcggggcgcccttccgaggcgcaccctggcctgtactatggcgccgacgagcag
tgccgcgtcgccttcggcccgacggcggtcgcctgcaccttccgcagggagcacctagac
atgtgccaggctctctcctgccacacagaccccctggaccaaagcagctgtagccgcctc
cttattcctgtcctggatgggacagagtgtggcgtggggaagtggtgctccaaggggcac
tgccgctccctggcggagctggcccccgtgggggcggtgcacgggcactggtctagctgg
ggtccggccagtccttgctcccgctcctgcggaggaggtgtggtcaccaggagacggcag
tgcaacaaccccagacctgcgtttggggggcgtgcgtgcgtaggtgctgacctccaggcc
gagatgtgcgacagccaggcctgcgagaagacccagctggagttcatgtcggagcagtgt
gcgcagaccaacggggagcccctgcgcctctccccgggcagcacctccttctaccgctgg
ggcacggccgagcagtacagtcgaggggacgctctgtgtagatatctgtgccgggccatt
ggcgagagcttcattgtgaggcgtggggacagtttcctggatgggacacggtgtgtgcca
agcagccctcaggaggatgggaccctgagcctgtgcgtgtcaggcagctgcaagacgttt
ggctgtgacggcaggatggcctccgggcaggtgcgagatgtgtgccaggtgtgtggcggg
gacaacagcacgtgccgtcctcagaacggctctttcacggccgggagagccagagagtat
gtcacattcctgaccgttacccccaacctgaccagcatatacgtcatcaaccacaggcct
ctcttcacgcacctggcagtgaggatccgtgggcgctacgtcgtggccggaaatgcgagc
atctctcccagcaccacctacccctccctcctggaggacagccgcatccagtacaaagtg
accctgactgaggaccggctgccccgcctggaggagatccgcatccagggccccacccag
gacgacatggagatccaggtttacaggcgctacggtgaggagtatggcagcctcgcccgc
ccagacatcaccttcacctacttccagcccaagcgtcggccggcctgggcgtgggctccc
gtgcggggggcctgctcggtgagctgtggggcagggctgcgctgggtgacccacagctgt
cgggaccaggcagcgaacgagtgggtggaggctgcccggtgcgcagggagccggcagccg
gcggcgtggtccgagtcatgtacctccgtaccctgtcccccgtcacaggagatgccggat
gcgtgctcgtcggcctgtggaacagatccggccgtgcagaacacgacgtgtgtgcagggg
gcagatggcatgggggcgccagcaactgctgggccctgctccgcagacgagaagccgcct
gcccttgagccctgtatcgaggtgtcatgtcctccgggctggggccattcagatgccccg
tctccaggggagaatgctgcatccccagcgggcagtgccaggccagaggctcatgccaca
cacgtgtggactcccttggcgggaccgtgctccgtctcctgtggtcaaggcctgatggag
ctgcgtttcgtgtgcatggactctgccctcgggacacccgtccgggaagagctgtgtgac
ctggcaagcaagcctgggggccggcgggaggtctgccaggctgccccgtgcccggcttgg
tggcggtaccagctggcggcctgcagcgtgacctgtgggggaggagtcgcacagaggatc
ctgtactgcgcccgggcccacggggaggacaaggccgaggagatcctgccggacacccag
tgccaggggctgcctcgcccggagcagcaggaggcctgcagcccagagccctgcccgccc
aggtggaaggtcatgttccttggcccatgttcagccagctgtggtctcggcactgccatg
cgcttggtggcctgtgtgcagctggaccaaggccaggacacagaggtggacggggcggcc
tgtgtaggtctggtgcggccgcaggccagcatcccctgcatcatcgccgactgcacctac
cggtggcacgtcagcgcctggatgcagtgctctgtctcgtgtggggatggcatccagcgc
cggcacgacgcctgccttggaccccaggcccgggtgcccgtgccagccgacttctgccag
catttgcccaagccggtgacggtgcggggctgttgggctgggccctgtgcagggcagggg
acacccagcccggtgccccacgaggaatccactgctcctggccagaccacagctgccact
gcttccccgcggtggccccagccccaggcccacctcctctccccagctgcccggccgcaa
ggacgccctcccgggccccaggaaagcccagcagagtccagcacctgtggccggcagcac
cttgagccgacaggaaccattgacatgcgaggcccagcgcgggcggactgtgcagtggcc
atcgggcggcccctgggtgaggtggtgaccctccgagtcctcgacagttccctcaactgc
agtgctggggagatgctgctgctttggggcaggctcacgtggaggaagatgtgcgggaag
ctgcccggcatgactttcagctccaaagccaacacgctggtggtgaggcagcgtcttgtg
cagctgcgaggcggagtgctgcttcggtattcgagccagcctgccccgggagccttccac
cgaggatgtgacatgcagctctttgggccccggggtgaaatcgtgagtccatcattgagt
ccggatgggaggaacatggggggctgccgaatcttcatcgacgtggccccacaggcccgg
atcgccatccgtgccctggccatggacacgggcaccagaaccgaggaaacggattccagc
tacatcttgatccgggatatccacagcctgaggacaacgacatttcgtgggcaacagacg
ctctactgggagtcagagggcagccaggcagagatggagtttagccagggcttcctggag
gcgcacaccagccttcggggccagtactggaccctccaggctagagctcattag

DBGET integrated database retrieval system