KEGG   Orcinus orca (killer whale): 101281945
Entry
101281945         CDS       T05247                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00230  Purine metabolism
oor00240  Pyrimidine metabolism
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101281945 (DCK)
   00240 Pyrimidine metabolism
    101281945 (DCK)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101281945 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 DUF932 CoaE
Other DBs
NCBI-GeneID: 101281945
NCBI-ProteinID: XP_004283618
Position
Unknown
AA seq 260 aa
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFKELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
EPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTVKTNFDYLQEVPILTLDVNE
DFKDKHDSLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccatctcccgcagccagctctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctgggaagtcaacatttgtgaatatc
cttaaacaagtctgtgaggattgggaagtggttcctgaacctgttgccaggtggtgcaat
gttcagagtactcaggatgaatttaaggaactgacaacgtctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaaacctgaacggtggtctttcaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgctgctctcaatggcaagctcaaagatgcagag
gaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatacttagagaagcttcactataagcatgaaagctggctcctgcatagaaca
gtaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctggttgaaaaggtaaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system