KEGG   Orcinus orca (killer whale): 101283485Help
Entry
101283485         CDS       T05247                                 

Gene name
PARP3
Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03410  Base excision repair
oor04210  Apoptosis
oor04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101283485 (PARP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101283485 (PARP3)
   04217 Necroptosis
    101283485 (PARP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oor03032]
    101283485 (PARP3)
   03036 Chromosome and associated proteins [BR:oor03036]
    101283485 (PARP3)
   03400 DNA repair and recombination proteins [BR:oor03400]
    101283485 (PARP3)
Enzymes [BR:oor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101283485 (PARP3)
DNA replication proteins [BR:oor03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101283485 (PARP3)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101283485 (PARP3)
DNA repair and recombination proteins [BR:oor03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101283485 (PARP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP_reg PARP WGR
Motif
Other DBs
NCBI-GeneID: 101283485
NCBI-ProteinID: XP_004268080
Position
Unknown
AA seq 542 aa AA seqDB search
MAPKRKPQVQREGPEKKKGRQGAQEEDSFRSTAEALXPTEKRIAXVGPLCPLSCNPRTQV
HEDYDCTLNQTNTGSNKNKFYIIQLLEEGDCFICWNRWGRVVKVGQSQLSRFMSLEDAQK
DFEKKFRDKTKNSWAERDHFVAHPSKYTLIEXQREDEAQEAMVKVDRGPVRTVVRVQQVQ
PCSLDAATQKLITNIFSKDMFKNAMAGLPWWHSDVKKMPLGKLSKQQISRGLEALEAVEA
ALKAPAGRGLSLEELSSHFYTIIPHNFGRSQPPPINSPELLQAKKDMLLVLADIELAQTL
QAAPEETKKVEEVPHPLDRDYQLLKCQLQLLDPKVPEYKVIHPCLEKTGSKYSCPALQHS
WTVNREGEGDQFQAHDKLGNRKLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASE
NSKSDGYVTGMSCGAHDIGYMFLGAVAVRREYRITVYEPSLKQHPPGFDSVITRGHTEPV
PTQDTKLELDGQQVVVPQGQPMPCPEFSSSSFFQISSPKVMGVMDWHYYWDTDTAAYSSL
CS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaagcgcaagccccaggtacagcgtgagggtcctgagaagaagaaggggcgt
cagggggcacaagaggaggacagtttccgctccactgccgaggccctcncacccacagag
aagcgcatagcctaagtgggccccctgtgcccactcagctgcaaccctaggacccaggtg
catgaagactacgactgtaccctgaaccagaccaacactgggagcaacaaaaacaagttc
tacatcatccagctgctggaagaaggtgactgctttatctgctggaaccgctgggggcgc
gtggtgaaggtgggccagtcacaactcagccgcttcatgtcactggaggatgcacagaag
gactttgaaaagaagtttcgggacaagaccaagaacagctgggcagagcgggaccacttt
gtggcccaccccagcaagtatacacttatcgagntacagagagaggatgaggcccaggaa
gccatggtgaaggtagacagaggcccagtgaggaccgtagttcgtgttcagcaagtgcag
ccctgctccctggacgcagccacacagaagctcatcaccaacatcttcagcaaggacatg
ttcaagaatgccatggctgggcttccctggtggcacagtgatgtgaagaagatgccactg
gggaagttgagcaagcagcagatttcccggggtttggaggccttggaggcagtggaggcg
gccctgaaagcccccgcaggtcgtggtctcagcctggaggagctgtcctcccacttctac
accatcattccccacaacttcggccgtagccagcccccacccatcaactccccggaactt
ctgcaggccaagaaggatatgctgctggtgctggcagacatcgagctggcccagaccctg
caggcagcccccgaggagacaaagaaagtggaggaggtgccacacccactggaccgagat
taccagctcctcaagtgccagctccagctgctggacccaaaggtgcctgagtacaaggtg
atacatccctgcttggaaaagactggcagcaagtacagttgccctgctcttcaacatagt
tggacagtgaaccgagaaggggagggagatcagttccaggcccacgacaagctgggtaat
cggaagctactgtggcacggcaccaacgtggctgtggtggccgccatcctcaccagtggg
cttcgcatcatgccacattctggtggccgtgttggcaaaggcatctactttgcctcggag
aacagcaagtcagatggctatgttactggcatgtcctgcggggcccatgacattggctac
atgttcctgggtgcggtggcagtgcgcagagagtaccgcatcaccgtctatgagcccagc
ttgaagcagcacccccctggcttcgacagtgtcattacccgtggccacacagagcctgtt
ccaactcaggacaccaagctagagctggatggccagcaagtggtggtgccccagggccag
cccatgccctgcccagagttcagcagctccagcttcttccagatctcgtctcctaaggtg
atgggtgtgatggattggcattattactgggacacggatacagcagcctattcaagcctg
tgtagttag

DBGET integrated database retrieval system