KEGG   Orcinus orca (killer whale): 101284266Help
Entry
101284266         CDS       T05247                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis protein 6 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101284266 (DOCK6)
Membrane trafficking [BR:oor04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101284266 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 101284266
NCBI-ProteinID: XP_004277430
Position
Unknown
AA seq 2082 aa AA seqDB search
MAVAERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRCSSSLGVPLTEVIEPLDFEDVL
LSRPPDAEPGPLRDLVEFPADDLELLLQPRECRTTEPGIPEDGKLDAQVRAAVEMYTEDW
IIAHRRYQHLSAAYSPITLETQRERQKGLTRQVFEQDASGDERSSPDDSDDPRHSSGSPD
DTPRSSGASGIFDLRNLAADSLLPSLLERMAPEDVDRRNEALRRQHRSRALLTLYPAPDE
DEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDL
NSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMV
MKEVDTAKNKEKLEKLRLGAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQSDRDSDSEGE
RRPTWTDRRRRGPQDRTSSGDDACSFSGFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPTSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFPAREV
YAPHTSYRNLLYVYPHSLNFSSRQGSVRNLTVRVQYMAGEDPSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVSCQPRPGTALETPVGFTWIP
LLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQ
DPYLDKFFTLVHVLEEGAFPFRLKDAVLSESTVEQELRASLVALRLASPEPLVAFSHHVL
DKLVRLVVRPPIIGGQIVNLGRVAFEAMAHVVSLVHRSLEAAQDARGHCPLLAAYVYYAF
RLPGTEPSLPGGAPKVTLQPATLAHGPGRPASLYLARSKSISSSNPDLAVAPGSVDDEVS
RILASKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGADPRQLLHEELALQWVVSGSAVRE
AVLQHAWFFFQLMVKSMALHLLLGQKLDTPRKLRFPGRFLDDIAALVGSVGLEVITRVHK
DVELAEHLNASLAFFLSDLLSLVDRGFVFSLVRAHYKQVATRLQSAPNPAVLLTLRMDFT
RILCGHEHYVTLNLPCCPLSPPASPSPSVSSTTSQSSTFSSQAPDPKVISMFELSGSFRQ
QHFLAGLLLTELALALEPEAEGASLLHKKAISAVHSLLCGHDADPRYAEATVKARVAELY
LPLLSLARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDMGGTINPSVAMAIAGGPLAP
GSRASISQGPATAARSGCALSAESSRTLLVCVLWVLKNAEPALLQRWAADLALPQLGRLL
DLLYLCLAAFEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPF
GNQENVRWRKSVTHWRQTSDRVDKTKDEMEHEALVDGNLATEASLVVLDTLEIIVQTVML
SEARESILGAVLKVVLYSLGSAQSALFLQHGLATQRALVSKFPELLFEEDTELCADLCLR
LLRHCGSRISAIRTHASASLYLLMRQNFEIGHNFARVKMQVTMSLSSLVGTTQNFSEEHL
RRSLKTILTYAEEDVGLRDSTFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLIDLMYRI
ARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCV
SFQNISSNVLEESAISDDILSPDEEGFCSGKHFTELGLVGLLEQAAAYFTMGGLYEAVNE
VYKTLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGARFGDLD
EQEFVYKEPSITKLAEISHRLEEFYTERFGEDVVQIIKDSNPVDKTKLDPQKAYIQITYV
EPHFDTYELKDRVTYFDRNYGLRTFLFCTPFTPDGRAHGELPEQHKRKTLLSTDHAFPYI
KTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQG
PLEVAQVFLAEIPQDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELER
NYSRLREALQPLLTQRLPQLLVPNTAGFRNSLNRASFRKADL
NT seq 6249 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagccgagcgccgcgccttcgcgcacaagatcaacaggacggtggctgccgag
gtgcggaagcaggtgtcccgggaacgcagtggctctccccactccagcaggcgctgcagc
agctccctgggggtcccactgactgaagtcattgagccactggactttgaggatgtgctc
ctgagccggccgccagatgcagagcctgggccactccgggacctggtcgagtttccagct
gatgacctggagctgctgctgcagccccgggaatgccgcaccacggagcctgggatcccc
gaggatggaaagctggatgcccaggtgagggctgccgtggagatgtacacggaggactgg
atcatcgcccacaggaggtaccagcacctgagtgcagcatacagccccatcaccctagag
acgcagcgagagaggcagaagggcctcacccgccaggtcttcgagcaggacgcttctggg
gatgagaggtccagcccggacgactcggatgacccccggcactcctcaggctccccagac
gacaccccacgaagcagtggtgcctctggcatcttcgacctgaggaacttggcagccgac
tcattgctgccctcactgctggagcgcatggccccggaggatgtggaccggcgcaatgag
gccctgcggcggcagcaccggtcccgtgccctgctcaccctctacccggcgcccgacgag
gatgaggccgtggaacgctgcagccgcccggagccaccccgagagcactttggacagagg
atcctggtcaagtgtctgtcgcttaagttcgagatagaaatcgagcccatctttggcatc
ttggccctgtacgacgtgcgggagaagaagaagatctcggagaacttctactttgacctg
aactcagactccatgaaggggctactgcgggcccatggcacccatcctgccatctccacc
ctggcccgctctgccatcttctccgtgacctatccctcgcccgacatcttcttggtcatc
aagctggagaaggtgctgcagcagggggacatcagcgagtgctgcgagccctacatggtg
atgaaggaggtggacacagccaagaacaaagagaagctagagaagctgcgcctgggggct
gagcagttctgcacccgtctgggccgctaccgcatgccctttgcctggacggcggtgcac
ctggccaacattgtgagcagcgcgggccagtcggaccgggactcggactcggagggcgag
cgccgacccacttggactgaccgccgccgtcgggggccccaggaccggacgagtagcggg
gacgacgcctgcagcttctccggcttccgcccagccacgctaactgtcaccaacttcttt
aagcaggaagctgagcggctcagtgatgaggacctcttcaagttcctggctgacatgcgg
cgcccgacatccctgctgcggcgcctgcggcccgtgaccgcccagctcaagattgacatc
tccccagcccctgagaacccccacttctgcctctccccggagctgcttcatgtcaagccc
tacccagaccccaggggtcggcccaccaaggagattctggagttccccgcccgtgaggtc
tacgccccccacaccagctacaggaacctgctgtacgtgtacccgcacagcctcaacttc
agcagccgccagggctccgtgcgcaacctcactgtgcgagtgcagtacatggcgggcgag
gaccccagccaggccctgccggtcatctttggcaagtccagctgcagcgaattcacccgc
gaggccttcacaccagtggtctaccataacaagtcccctgaattctacgaggaatttaag
ctgcgtcttccggcctgtgtgaccgagaaccaccacctgctgttcaccttctaccacgtc
agctgccagccccggccaggcacggccctggagactcctgtgggctttacttggatccca
ctgctgcagcacggccgcctgaggaccggccccttctgcctccctgtgtccgtggatcag
cccccgcccagctactccgtgctcacaccggacgtggcgctgccgggcatgcgctgggtg
gatggccacaagggtgtgttcagcgtggagctcacggctgtgtcgtctgtgcacccccag
gacccctacctggacaaattcttcaccctggtgcacgtcctggaggaaggggcctttcca
ttccggctcaaggatgccgtgctgagcgagagcaccgtggaacaggagctgcgggccagc
ctggtggccctgcgactcgccagccctgaaccccttgtcgccttctcccaccacgtactg
gacaagctcgtacgcctggtcgtgcggccccccatcatcggcggccagatcgtaaacctg
ggtcgtgtagcctttgaagcaatggctcatgtagtcagcctcgtccaccggagcctggag
gctgcccaggatgcccgtggtcactgcccactgctggctgcctatgtctactatgccttc
cgactgcctggcacggagcccagcctcccaggtggggcccctaaagtgacgctgcagcct
gccacgctggcccatggccctggccgccccgcaagcctctacctggcccgctctaagagt
atcagcagcagcaaccctgacctggccgtggcccctggctccgtggatgacgaggtctcc
cgcatcctggccagcaagggtatcgaccgctcacactcctgggtgaattctgcttatgct
ccaggaggcagcaaggcggtgctgcgacgggcacccccttattgtggggccgaccccaga
cagctgcttcacgaggagctggccctgcagtgggtggtcagcggcagtgccgtgcgcgag
gctgtcctgcagcatgcctggttcttcttccagctcatggtgaaaagcatggcgctgcac
ctgcttctgggccagaagctggacacaccccgcaagcttcgcttccctgggcgcttcctg
gatgacattgctgccctggtgggctctgtgggcctggaggtcatcacccgcgtccacaag
gacgtggagctggccgagcacctcaacgccagcctggccttcttcctcagtgatctgctg
tccctggtggaccgcggctttgtcttcagcctggtccgggctcactacaagcaggtggcc
acacggctgcagtcggctcccaacccggcggtgctgctgaccctgcgcatggacttcacc
cgcatcctatgcggccacgagcactacgtgaccctcaacctcccttgctgccccctgtca
cccccggcctcaccctcgccctccgtatcttccaccacctcgcagagctccaccttttcc
agccaggccccagaccccaaggtgatcagcatgttcgagctgagtgggtcgttccggcag
cagcacttcctggctgggctcctgctgacggaactggccctggccctggaacctgaggcc
gagggggcgtccctgctgcacaagaaggccatcagtgctgtccacagcctgctctgtggc
catgatgctgacccccgctacgccgaggccactgtgaaggcccgggtggccgagctatac
ctgccactgctgtcactggcgcgggacacactgccacggctgcatgactttgctgagggt
ccaggtcagcggtcaagactggcctctatgctcgactcagacacagaaggggaaggggac
atgggaggcaccatcaacccctcagtggccatggccatcgctggtggccccctggcccct
ggctcccgggccagcatctcccagggcccagcgacagctgctcgctcgggctgtgccctc
tccgccgagtctagtcggaccttgctggtgtgtgtgctgtgggtcttgaagaatgctgag
ccagccctgctgcagcgctgggctgcggacctggccctccctcaactgggtcgtctcttg
gacttgctgtacctctgtctggctgcctttgaatacaaggggaaaaaggcctttgaacgt
atcaacagtctcacgttcaagaagtcactggacatgaaggcccggctggaggaagctatc
ttgggcaccattggagcccgacaggagatggtgcgacggagccgtgagaggagcccattt
gggaaccaggagaatgtacgctggcggaagagcgtcacacactggagacaaacctcggac
cgtgtggacaagaccaaggatgaaatggaacacgaggccttggtggacgggaacctggca
accgaggcaagcctggtagttctggatacactggagatcatcgtgcagacggtgatgctg
tcagaggcccgggagagtatcttgggcgcggtactgaaggttgtgttgtacagtctgggc
agtgcccagagtgccctcttcttgcagcacggcctggccacacagcgggccctggtatcc
aagttcccagagctgctgtttgaggaggacacagagctgtgtgccgacctctgcttgagg
ctcctgcgacactgcggcagccgcatcagcgccatccgtacgcacgccagcgcctccctc
tacctcctcatgcgccagaatttcgagattggccacaactttgcccgcgtgaagatgcaa
gtgaccatgtcactttcgtccctggtggggacaacgcagaacttcagcgaagagcacctg
cgacgttcactcaagaccatcctcacctatgccgaggaggatgtggggctgcgggacagc
acctttgctgaacaggtccaggacctgatgttcaacttgcacatgatcctgactgacacg
gtgaagatgaaggagcatcaggaggacccggaaatgctcattgacctcatgtacaggatt
gcccggggctaccagggctccccagacctgcggctgacatggctgcagaacatggcgggg
aagcacgcagagctgggcaaccacgcggaggctgcgcagtgcatggttcacgcggccgcc
ctggtggccgagtacctcgctctgctggaggacagccgccacctgcctgtgggctgtgtt
tccttccagaacatctcgtccaacgtgctggaggagtccgccatctctgacgacatcctg
tcgcctgatgaggagggcttctgttccgggaagcacttcacggagctggggctggtgggg
ctgctggaacaggcggccgcctacttcaccatgggtgggctctacgaggcagtgaatgag
gtctacaagaccctcatccccatcctggaagcccaccgcgactacaagaagctggctgct
gtgcacggcaaactgcaggaggccttcaccaagatcatgcaccagagctccggctgggag
cgtgtgttcgggacatatttccgcgtgggcttctacggtgcccgctttggtgacctagat
gaacaggagttcgtgtacaaggagccatccatcacgaagctggccgagatctcacaccgg
ctggaggagttctacacggagagatttggggaggacgtggtccagatcatcaaagattct
aaccctgtggacaagaccaagctggacccccagaaggcctacatccagatcacgtatgtg
gagccgcatttcgacacctatgagctcaaggaccgggtgacctacttcgaccgcaactac
gggctgcgaaccttcctgttctgcacgcccttcacgccggacgggcgcgcacacggagag
ctgcctgagcagcacaagcgcaagacgctgctcagcacagatcacgccttcccctacatc
aagacacgaatccgcgtgtgccaccgggaggagacagtgctgacgccagtagaggtggcc
attgaggacatgcagaagaagacccgggagctggccttcgccaccgagcaggacccgcct
gatgccaaaatgctgcagatggtgctgcagggctccgtggggcccactgtaaaccagggt
ccactggaggtggcccaggtgtttttggccgagatcccgcaagaccctaagctcttcagg
catcacaacaagctgcggctctgtttcaaggacttctgcaagaagtgcgaggatgcgctg
cggaagaacaaagccctgattgggccggaccagaaggagtaccaccgtgagctggagcgc
aactactcccgcctgcgggaggctctgcagcctctgctcacccagcgcctgcctcagctg
ctggtgccaaacacagccggcttcaggaactccttgaacagagcaagtttccggaaggct
gacctctga

DBGET integrated database retrieval system