KEGG   Orcinus orca (killer whale): 101285220Help
Entry
101285220         CDS       T05247                                 

Gene name
MRPL22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial isoform X1
  KO
K02890  large subunit ribosomal protein L22
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03010  Ribosome
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    101285220 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:oor03011]
    101285220 (MRPL22)
Ribosome [BR:oor03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    101285220 (MRPL22)
  Bacteria
    101285220 (MRPL22)
  Archaea
    101285220 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 101285220
NCBI-ProteinID: XP_004281039
Position
Unknown
AA seq 210 aa AA seqDB search
MAAAILDRMGALWMQNLRGKLALGHFSSHSVLPQSHIHTSASLEISRKWEKKNKIVYPPQ
LPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLL
EAQDMAVRDHNVEFRSNLYIAQSTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLVEGP
PPPPEAPKTAVAHAKEYIQELRNRTIIHTL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcaatactggatcgtatgggtgcgttatggatgcagaatctgagggggaag
ctggccttggggcatttttcatctcacagcgttttaccccaatcacatattcacacaagt
gcttctcttgaaatatctcgaaaatgggagaagaagaataaaattgtttatcctccacaa
ctgcctggagaacctcggagaccagctgaaatctaccattgtcgaagacaaataaagtac
agcaaagacaagatgtggtatttggcaaaattgatacgaggaatgtccattgaccaggct
ctggctcagttggaattcagtgacaaaaaaggggcccagataattaaagaggttctctta
gaagcacaagatatggcagtgagagaccacaatgtggaattcagatccaatttatatata
gctcagtccacctcagggcgaggccagtacctgaaacgcatccgataccacggcagaggt
cgctttgggattatggagaaggttttttgccattattttgtgaagttggtggaaggccct
ccacctccacctgaggcaccaaagacagcagtcgcccatgccaaagagtatatccaggag
cttcgcaaccggaccatcattcacactctatga

DBGET integrated database retrieval system