KEGG   Orcinus orca (killer whale): 101285570
Entry
101285570         CDS       T05247                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00100  Steroid biosynthesis
oor01100  Metabolic pathways
Module
oor_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101285570 (TM7SF2)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101285570 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 101285570
NCBI-ProteinID: XP_004264387
Position
Unknown
AA seq 417 aa
MVPQGSRAELEFGGPLGAAALLLLLPATMFHLLLVARSGPARLLGPPPYLPELEELWSPW
ALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLSYPINGFQALVLTAMLVGLGVLAGL
PLSALPEMLLPLAFAATLIAFIFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELNP
RICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWHE
EAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPEPLGLPLALVICLINAVGY
YIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALAW
SLPCGVSHLLPYFYLLYFTALLVHREARDEQQCLRKYGLAWHAYCRRVPYRIVPYIY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggtccctcagggctcccgggctgagctggaattcggaggacccctgggcgctgcggca
ctgctgctgctgctccccgccaccatgttccacctgctactggtagcccgctcgggcccg
gcgcgcctcctgggcccacccccttacctgccggaactcgaggagctgtggagcccttgg
gcgctgttgctgtgtctcacctggctcggcctgcaggcggcgctctacctcttgccggcg
cgcaaggtggccgaggggcaggaactgaaggacaagagtcgactgagctaccccattaac
ggcttccaggccctggtgctgacagccatgttggtgggcctgggagtgttagccgggctg
cccctgagcgcgctcccggaaatgctcctgcccttggcctttgcggccaccctcatcgcc
ttcatcttcagcctccttctctatctgaaggctctggtagcccctgcctctgccctggca
cccggggggaactcaggcaatcccatttacgactttttcctgggacgggagctcaacccg
cgcatctgttcctttgacttcaaatatttctgcgaactgcggcctggcctcatcggctgg
gtcctcatcaacctggccttgctgatgcaggaagcagaacttcgggggagtccctcactg
gccatgtggctggtcaatggcttccagctactatatgtgggtgatgccctttggcacgag
gaggcggtcctcaccaccatggacatcatacatgacgggtttggcttcatgctggccttt
ggggacctcgcctgggtacccttcacctacagcctgcaggcccagttcctgctgtaccac
ccagagcccctggggttgcccctggccttggtcatctgcctcatcaatgctgttggttac
tacatcttccgtggagccaattctcagaaaaacaccttccggaagaatccttctgatccc
agagtggctgaccttgagaccatctctacagccacagggcgacggctgctggtgtctggg
tggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcctgg
tccttgccctgcggggtgtcccacctgttgccctacttctacctcctttacttcactgcg
ctgttggtacaccgtgaggcccgggatgagcagcagtgtctgcggaagtatggcctggcc
tggcacgcatactgccggcgtgtgccctaccgaatcgtgccctacatctactga

DBGET integrated database retrieval system