KEGG   Orcinus orca (killer whale): 101286253Help
Entry
101286253         CDS       T05247                                 

Gene name
WNK3
Definition
(RefSeq) serine/threonine-protein kinase WNK3 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101286253 (WNK3)
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101286253 (WNK3)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101286253 (WNK3)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: Other
  Wnk family
   101286253 (WNK3)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101286253 (WNK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 101286253
NCBI-ProteinID: XP_004284810
Position
Unknown
AA seq 1792 aa AA seqDB search
MDTDSGGPASTEDSEKPDGVSLENRVRQVAATLTVEARLKEKNSTFCASGETIERKRFFR
KSVEMTEDGKVAESSSKDERIKTATNIPRVEKLPTNVLRGRQEVKYEQCSKGMSESSKDC
FKEKNEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQD
RKLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLK
RFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL
MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRK
VTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSVRDLLNHAFFAEDTGLRVELAEEDD
CSNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
AKSIRDRVALIKKTREKKPAGCLEERRDSQCKSVGNVLPQPQNTALPPPPAQHSGAECEE
TEVDQHVRQQLLQRKPQWHCSSVTSDSLSEAGAGSVIHSETSNQPSIAYSSDQMMGSQMV
SNNPQAEINVPGKIYPSQQLVGHHQQISGLQKQPKLTQPQILPLLQGQSTVLPVHVLGPP
LVSQLQFLPLSVPKVSQVKPVSQAVGAEQTATLLKPDLVRSLNNDVAAVKENTNTPDNPS
GNGKQDRIKQRRASCPRSEKGTKFQLTVLQVSISGDNMVECQLETHNNKMVTFKFDVDGD
APEDIADYMVEDNFVLESEKEKFVEELRAIVGQAQEILHVHSAAERAIGVDSITMESSSS
QTGSSEQVQINSASTQTSNESAPQSSPVGRWRFCINQTIRNRDAQSPSSLQQSMSTVPGL
NLLSSPRNISNKEISQDTLLTLENNPCQRALYTSTSEHKDVVDGKISEYASVETKQPAIL
YQVEDDKQIMAPVASSSSLECEGLTSQAGIFLPVYPGHQAASQAAPGESTQIAPNSLTTP
AFMSDQKPQSLPVQQPTMDAEFISQEGETAVIVEASSPKMVIPTQTPGLEPTSLLSSTVL
ESDGEGPPKMEFADNRIKTLDEKLRNLLYQEHSISSIYPESQKDTQSIDSPFSSSAEDTV
SCPVPEVIGISHCGIQDSPAQSPNFQQTGSKILSNVTVSQPANISVFKRDLNVITSIPSE
LCLHEMSPDASLPGDPEAYPAAVSSGGAIHLQTGGGYFGLSFTCPSLKNPISKKSWTRKL
KSWAYRLRQSTSFFKRSKVRQVDTEDTRSPVAPDPIPLTGESTADARAFSRCKAMSGSFQ
RGRFQVITVPQQQSVKVTSSGIEHIPAFNKMTSQPSEEALAFTKTAKSQLVEMEPATHNL
QPSLSSQKLQALQETLKEDKRIPKQADNFSSFSMACETVVSLMTPEKALEENSATGSSMQ
SGSELLFKEREILTAGMQPTSNSEFSATLGGRGKSVAKSGPERVKCLPLREEKAYVQTQS
SLFYSPSSPMSSDDESEVEDEDLKVELQRLREKHIQEVVNLQTQQNKELQELYERLRAIK
DGKVQSSEIPLPPASPRRPRSFKSKLRSRPQSLTHVDSGTVVTGKSILKLGEMENPLCAA
ESSAASCQQSPASKKGMFTDDLHKLVDDWTKETVGNSLIKPSLNQLKQSQQKLETDNWNK
VYENTPSTMGYTSTWISSLSQIRGAVPASLPQGLSRPSFPGPLSSYGIPHVCQYNAVGGP
GYPVQWVGISGTPQQSVVIPTQSGGLFQPGMNLQAFPASSVQNPSAIPPGPK
NT seq 5379 nt NT seq  +upstreamnt  +downstreamnt
atggatactgattcaggagggccagctagcacagaagattctgagaaacctgatggagtt
tcattggaaaacagagttcgtcaggttgcagcaactttgaccgtggaagctagactaaag
gagaaaaacagtaccttctgtgcttctggagaaactatagaaaggaaaagattctttcga
aagagtgttgagatgacagaagatggcaaagttgctgaatcttcctccaaagatgagaga
ataaagactgcaacaaatattccaagagtagaaaagcttcctacaaatgtgctaagaggc
agacaagaagttaaatatgagcagtgttcaaagggaatgtcagaatcctcaaaagattgt
ttcaaggagaaaaatgaaaaggaaatggaagaagaagcagaaatgaaggctgtagctact
tctcctagtggcaggttcctgaaatttgacatagagctgggaagaggagcatttaaaaca
gtatataaaggactggacactgaaacatgggttgaagttgcttggtgtgagctgcaggac
cggaaattaaccaaagctgagcagcaaaggttcaaggaagaagcagagatgttaaagggt
ctccagcatcccaatatagttcgattctatgattcctgggagtctatactaaaaggaaag
aaatgtattgtattagtgactgaacttatgacatcaggaaccttaaagacgtacttaaaa
cgatttaaagtcatgaaaccaaaggtcttaaggagctggtgcaggcaaattttaaagggg
ttgcagttcttgcacactaggactcctcctattattcaccgggatctgaagtgtgacaat
attttcatcacgggacccactggatctgtgaagattggtgatctaggactagccacctta
atgcgcacatcatttgctaaaagtgtcattggcactcctgagtttatggccccagagatg
tatgaagagcactacgatgaatctgtggacgtctatgcttttggaatgtgtatgctagaa
atggctacttcggagtacccttattctgagtgccagaatgcagctcaaatataccgtaaa
gtaactagtggtataaaaccagccagtttcaataaagtcactgatcctgaagtgaaagaa
atcatcgagggatgtattcgtcaaaataaatctgaaaggttgtctgtcagggacctacta
aaccacgcattttttgctgaagatacagggctaagggtggagttagcggaggaagatgat
tgctcaaattcatctctggctttaaggctctgggttgaagaccctaaaaaattgaaaggc
aagcataaagacaatgaagctattgaattcagtttcaatttagaaacagatacacctgag
gaagtagcatatgaaatggtcaagtcaggattcttccatgaaagtgattccaaagctgtt
gctaagtccattagagaccgggtggccctgataaagaagacaagggagaagaagccagct
ggctgtttggaagaacgcagagactcccagtgcaagtctgtggggaatgtactccctcag
ccccaaaatacagctttgccccctcctcctgctcagcacagcggggctgaatgtgaagaa
actgaagttgatcaacatgtgcgacaacagcttctgcaaagaaaaccacaatggcattgc
tcctctgttacaagtgacagtttgtctgaggcaggagctggatcagttatacattcagaa
acttcaaatcagcccagtatagcctactcctcagaccagatgatgggctctcaaatggtt
tctaacaacccacaggctgaaataaatgttccagggaaaatttatccatcccagcagcta
gtgggacatcaccagcagatttcagggttgcagaagcagccaaagctgactcagccccaa
attttgcctttgcttcaaggtcagtccactgttctgcctgtacatgtccttggacctccg
cttgtctcacaactccagtttttgccattaagtgtcccaaaggtctcacaggtaaagcct
gtatcccaagcagttggagctgaacaaacagcaactcttctaaaaccggatttagttcga
agtttgaataatgatgtggcagctgtgaaggaaaacaccaatacccctgataacccaagt
ggaaatggcaaacaagatcggatcaaacaaagaagagcttcctgtcctcgatcagagaag
gggactaaatttcagcttactgtccttcaggtgtcaatctctggagacaacatggtggag
tgtcaactggagacacacaataacaagatggtcaccttcaagtttgatgttgatggtgat
gcaccagaggatattgcagactatatggttgaagataactttgtcctggaaagtgaaaaa
gaaaaatttgtagaagaattgagggctatcgtaggtcaagcccaggagatccttcatgtc
cactctgctgcagaaagagccattggagttgactctattactatggaatccagcagtagc
caaacaggatcatctgaacaagtacagataaattctgcatccactcaaaccagcaatgaa
tctgctcctcagtcatccccagttggtcgatggcgattttgtatcaatcagacaataaga
aaccgtgatgctcaatctccttcttctcttcagcagtccatgtctacagttcctgggcta
aatctgctttctagtccaagaaacataagtaataaggaaatatcacaggacacgctgctc
actctagaaaataatccatgccagcgtgcactttacacctccacatcagaacacaaggat
gtagttgatggtaagatttctgaatatgccagtgtagaaactaagcagccagctatactt
tatcaagtggaagatgacaagcagataatggcaccagttgctagtagttccagtcttgaa
tgtgagggactcaccagccaagcaggcatattcctacctgtgtatccaggtcaccaagct
gccagtcaggcagctcctggtgagtcaactcagattgctcctaactctcttacaactccg
gcatttatgtctgatcaaaagcctcagtccttaccggtgcagcagccaactatggatgca
gagtttatttcccaagaaggagaaaccgcagtgatcgtggaagcaagttctcctaagatg
gtcattcccactcagacccctggccttgaaccaactagcctgctgtcctctacggtcctg
gaatcagacggggaaggacctccaaaaatggagtttgcagacaaccgaattaaaactctg
gatgaaaaattaagaaatttgctctatcaggagcatagcatatctagcatctatcctgag
agtcagaaggatacccaaagcatagattctccgttttcttcctctgctgaagacacagtc
tcatgtccagtgccagaagtcataggcatcagtcactgtggaattcaagatagtcctgca
cagtcccctaattttcagcagacaggctctaagattctgtccaatgtgactgtgagtcag
cctgcaaacatatcagtgttcaaaagggacctgaatgtgataacttctatacccagcgaa
ttatgtttacatgagatgtccccagatgcttcacttccaggggatccagaggcctatcct
gctgctgtgtcaagcggtggagccattcatctgcagacaggaggtggatattttggccta
agctttacttgtcctagtctcaaaaatcctattagcaagaaatcctggactcgcaaatta
aaaagctgggcatacaggctacggcagtcaaccagctttttcaagagatcaaaagtccgt
caagtggatacagaagatacgagatcaccagttgctcctgaccccattcctctgacagga
gagtccacagctgatgctagggctttcagtagatgtaaagcaatgagtggatcatttcag
cggggtcggttccaggtgattacagttcctcagcagcagtcagtgaaagtgacatcttct
ggaatagaacacataccagcattcaataaaatgacaagccagcctagtgaagaagcttta
gcctttactaaaacagcaaagtctcaattggtagaaatggaacctgccacacacaatctg
caaccttcactttcttctcagaagttacaagctcttcaggaaaccttaaaagaagataaa
agaattcccaaacaagctgacaacttctcatctttcagtatggcttgtgagactgttgta
tctttgatgactccagaaaaggcattggaagaaaattcagccacaggaagtagcatgcag
tctggatctgaactgttgtttaaagagagagagatacttactgctgggatgcagcctacc
tctaatagtgaattttcagccactcttggtggcagagggaaatcagtggcaaagagtggt
ccagagagagtaaagtgcttaccactccgtgaagaaaaagcctatgttcaaacacagagc
tcactcttctattcaccgtcttccccaatgagcagtgatgatgagtcagaagtagaggat
gaggacttaaaggtggagcttcaaagattacgagaaaaacacattcaggaggtggtaaat
cttcaaacccagcagaataaggagttacaggagctctatgaacgccttcgggcaattaaa
gatggcaaagtccaatcatcagagattcctctaccacctgcatcaccacgtagaccaaga
tcttttaaaagcaaacttcgaagccgtccccagtccttgacacatgtggacagtggcaca
gttgtaacaggtaaatcaatcttaaaattgggtgaaatggagaatccactgtgtgcggcg
gaaagtagtgcagcatcatgccagcaatctccagctagtaaaaaagggatgttcacagat
gacttacacaaactggtggatgactggacaaaggaaacagtaggaaattctcttattaag
ccaagtttaaaccaacttaaacagagtcaacagaaactagaaacagacaactggaacaaa
gtatatgaaaatactccatctactatgggctacacatcaacatggatttcttctctgtcc
caaatccgtggagctgtcccagcctccttgccacaaggactctcacgcccttcatttcct
gggccattatcatcatatggaataccccatgtttgtcaatataatgctgtgggggggcca
gggtatccggtacagtgggtaggaatttcaggaacaccacaacagtctgtagtaattcct
acccaatctgggggactgttccagccggggatgaatttgcaggcatttccagcttcatca
gttcagaatccatccgcgatccctcctggtcccaagtga

DBGET integrated database retrieval system