KEGG   Orcinus orca (killer whale): 101286925
Entry
101286925         CDS       T05247                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oor01002]
    101286925 (ERAP1)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101286925 (ERAP1)
Peptidases and inhibitors [BR:oor01002]
 Metallo peptidases
  Family M1
   101286925 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101286925
NCBI-ProteinID: XP_004263562
Position
Unknown
AA seq 942 aa
MIPLSVKRPLVTMSLLLSSLLMLLTVATPSWCQSSETTSPKASNRAPFPWNKMRLPEHII
PLHYDLMIHANLTTLTFGGTTEIEITASKPTSTIILHSHHLQISKAALRKGAGERQSEEP
LRVLEYPPQEQIALLAPEPLVVGLPYTIVIDYAGNLSESFYGFYKSTYRTKEGEVRILAS
TQFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VKMSTYLVAFIVSDFKSVSKMTKSGIKVSVYAVPDKINQAGYALDAAVTLLEFYEDYFSI
PYPLAKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFDKCFNAMEVDALNSSHPV
STPVENPAQIREIFDEVSYEKGACVLNMLRDYLGADAFKSGIVNYLQKYSYKNTKNEDLW
NSMASICPTDGTQQMDGFCSRGEHSSSSSHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYVKGPDDAAETGYLWHVPLTFITSNSDSVQRFLLKTRTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSSDRASLINNAFQLVSIGKLSIEKALD
LTLYLKRETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIGLLRDLIDKQTWTDE
GSISERMLRSQLLLLACVRKYQPCVQKAEGYFRQWQEANGNLRLPSDVTLAVFAVGAQNP
EGWDFLYSKYQSSLSSTEKQQIEFALCITHNKEKLQWLLDQSFKGDTIKTQEFPDILRTI
GRNPVGYPLAWQFLRENWNKLVQKFELGSSSIAYMVMGTTNQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQNEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatacctctgtccgtcaaacggccccttgtgaccatgtcccttctgctttcatcactg
ttgatgctcttaactgtggcaactccatcctggtgtcagagcagtgaaacaacatctcca
aaggctagtaacagggcaccatttccttggaataaaatgcgacttcctgagcacatcatc
ccacttcattacgatctcatgattcacgccaacctcaccactctgactttcgggggaacc
acggaaatagaaatcacagccagcaagcccaccagtaccatcatcctgcatagtcaccac
ctgcaaatatctaaggccgccctgaggaagggagctggtgagaggcagtccgaagagccg
ctcagagtcctggaatacccgcctcaggagcaaatcgcactcctggctcctgagccccta
gtggtcgggctcccgtacaccattgtcattgactatgctggcaatctttctgagagtttc
tatggattttataaaagcacctacagaaccaaggaaggggaagtgaggatacttgcatca
acacagtttgaaccaactgcggccagaatggcctttccctgctttgatgaacctgctttc
aaagcgagtttttcaatcaagatcagaagggagccaagacacctcgccatctccaacatg
ccactggttaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtgacc
gtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctgtcagcaag
atgaccaaaagtggcatcaaggtttccgtgtatgctgtcccagacaagataaatcaggca
ggttatgcactggatgccgcggtgactcttctagaattttatgaggattatttcagcatt
ccatatcccttagccaaacaagatcttgctgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacatacagggaatcttctctactgtttgatgctgaaaagtct
tctgcatcaagtaagcttggcatcacgatgactgtgtcccatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagtttgtgtctgtcagtgtgactcatccagaactgaaagttgaagattat
ttctttgataagtgttttaatgctatggaggtagatgcattaaactcctcacaccctgtg
tccacacctgtggagaatcctgctcagattcgggagatatttgatgaagtttcttatgaa
aagggagcttgtgttctgaatatgctgagggattatcttggtgccgatgcatttaaaagt
ggtattgtaaattatctgcagaagtatagctataaaaacacaaaaaacgaggacctttgg
aatagtatggcaagtatttgccctacagatggcacgcaacaaatggatggattttgttct
agaggtgaacattcatcttcatcttcacactggcgacaggaaggccttgatgtgaaaacc
atgatgaacacctggacgcttcagaagggctttcccctgataaccatcaccgtgagaggg
aggaatgtacacatgaagcaagagcactatgtgaaaggcccggacgacgccgcagaaact
gggtacctgtggcatgtcccattgacattcattaccagcaactcagactcagtccagcga
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgttggaatgaatggctattacatagtgcattatgaggatgatggatgggattct
ttgactggccttttaaaaggaacacacacggccatcagcagtagtgatcgggccagtctc
attaacaatgcttttcagcttgtcagcattggaaagctatccattgaaaaagccttggat
ttaaccttgtacttgaaacgtgaaactgaaatcatgccagtgttccaaggtttgaatgaa
ctgatacctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcagttc
aaggcctttctcatcgggctgctgagggacctcattgataagcagacttggacggatgag
ggctccatctcagagcgaatgctgcggagtcagctgcttctcctggcctgtgtgcgcaag
taccagccctgtgtgcagaaggcagaaggctatttcagacagtggcaggaagccaatggg
aatttgaggctgcccagcgatgtgaccttggcagtgtttgctgtaggggcccagaaccca
gaaggatgggattttctttatagtaaatatcaatcgtcattgtccagtactgagaaacag
caaattgaatttgctctctgtattacccacaataaagaaaagcttcagtggctactagat
caaagttttaagggagatacaataaaaactcaagagtttccagatattcttagaactatc
ggcagaaacccagtgggatatccactggcctggcagtttctgagggaaaattggaataaa
cttgtacaaaagtttgaacttggctcaagttccatagcctacatggtaatgggaacaaca
aatcagttctcgacaagagcacggcttgaagaggtaaaagaattcttcagctctttgaag
gaaaatgggtctcagctccgttgtgtccagcaaacaattgaaaccattgaggaaaacata
cgttggatggataagaattttgataaaatcagagtgtggctacaaaatgaaaagcttgaa
ctgctgtaa

DBGET integrated database retrieval system