KEGG   Orcinus orca (killer whale): 101289103Help
Entry
101289103         CDS       T05247                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04024  cAMP signaling pathway
oor04080  Neuroactive ligand-receptor interaction
oor04713  Circadian entrainment
oor04720  Long-term potentiation
oor04723  Retrograde endocannabinoid signaling
oor04724  Glutamatergic synapse
oor04728  Dopaminergic synapse
oor04730  Long-term depression
oor05014  Amyotrophic lateral sclerosis (ALS)
oor05016  Huntington disease
oor05017  Spinocerebellar ataxia
oor05031  Amphetamine addiction
oor05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101289103 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101289103 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101289103 (GRIA1)
   04728 Dopaminergic synapse
    101289103 (GRIA1)
   04720 Long-term potentiation
    101289103 (GRIA1)
   04730 Long-term depression
    101289103 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    101289103 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101289103 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101289103 (GRIA1)
   05016 Huntington disease
    101289103 (GRIA1)
   05017 Spinocerebellar ataxia
    101289103 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    101289103 (GRIA1)
   05033 Nicotine addiction
    101289103 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oor04040]
    101289103 (GRIA1)
Ion channels [BR:oor04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101289103 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF659
Motif
Other DBs
NCBI-GeneID: 101289103
NCBI-ProteinID: XP_004281054
Position
Unknown
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLSAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagtgacagctttgagatgacctatagattctgttcccagttctctaaa
ggagtctatgccatctttgggttttatgaacggaggactgtcaacatgctgacctccttc
tgcggggccctccatgtctgcttcattacaccaagctttcctgttgacacatccaaccag
tttgtccttcagctgcgtcccgagctgcaggatgccctcatcagtatcatcgaccattac
aagtggcaaaaatttgtctacatttatgatgctgaccggggtctgtccgtcctgcagaaa
gtcctagacacagcggccgagaagaattggcaggtgacagccgtcaacattttgacaacc
acagaggagggataccggatgctcttccaggacctggagaagaaaaaggagaggctggtg
gtggtggactgtgaatccgagcgcctcagtgctatcctgggccagattgtaaagctggag
aagaacggcattggctaccactatatccttgcaaatctgggtttcatggacattgactta
aacaaattcaaggagagtggagcaaacgtaacaggtttccagttggtgaactacacagac
accatcccggccaggatcatgcagcagtggaaaaacagtgatgctcgggaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgacggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaatcgatatctctcgccgggggaatgct
ggggactgcctggctaacccagctgtgccctggggccagggcatcgacatccagagagct
ctgcagcaggtgcggtttgaaggcttgacaggaaacgtgcaatttaatgagaaaggacgc
cggaccaactacaccctccatgtgatcgaaatgaagcacgacggcatccgaaagattggc
tactggaatgaagatgataagtttgtccctgcagccacggatgctcaagccgggggggat
aactcaagtgtccagaatagaacgtacatcgtcactacaatcctagaagatccttatgtg
atgctcaagaagaatgccaaccagtttgaaggcaatgaccgctacgagggctactgtgta
gagctggcagcagagattgccaagcatgtgggctactcctaccgtcttgagatcgtcagt
gatgggaaatatggagcccgcgaccctgacacaaaggcttggaatggcatggtgggagag
ctggtctatggaagagcagatgtggccgtggcccctttaactatcaccttggtccgggaa
gaggtgatagatttctccaaaccatttatgagtttggggatctccatcatgataaaaaag
ccacagaagtccaagccaggggtcttctccttcctggatcctttggcttatgagatttgg
atgtgtatcgttttcgcctacattggagtgagtgttgtccttttcctggtcagccgcttc
agcccctacgaatggcacagtgaagagtttgaggaagggcgggaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagcttgtggttctccttgggagccttcatgcag
caaggatgtgacatttctccaaggtccctgtccggccgcatcgttggcggcgtctggtgg
ttcttcaccttgatcatcatctcctcctacacagccaacctggccgccttcctgaccgtg
gagaggatggtatctcccattgagagtgccgaggacctagcgaagcagacagaaatcgct
tacgggaccctagaagcgggatccacgaaggagttcttcaggaggtctaaaatcgccgtg
tttgagaagatgtggacgtacatgaagtcagcagaaccatctgtgtttgtgcggaccacg
gaggaggggatgatccgagtaaggaaatccaaaggcaaatacgcctaccttctagagtcc
accatgaatgagtatattgagcagcggaaaccctgtgacaccatgaaagtgggaggtaac
ttggattccaaaggctatggcattgcgacgcccaaggggtctgccctaagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagtgct
ctgagcctcagcaatgtggccggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcgcgtagcgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaacgaagccatacggacatcgacactcccc
cgaaacagcggggcaggagccagcggtggcggcagtggagagaacggccgggtggtcagc
catgacttccccaagtccatgcaatcgatcccctgcatgagccacagttcagggatgccc
ttgggagccaccggattgtaa

DBGET integrated database retrieval system