KEGG   Orcinus orca (killer whale): 101289858
Entry
101289858         CDS       T05247                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00230  Purine metabolism
oor01100  Metabolic pathways
oor01522  Endocrine resistance
oor04015  Rap1 signaling pathway
oor04020  Calcium signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04072  Phospholipase D signaling pathway
oor04114  Oocyte meiosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04371  Apelin signaling pathway
oor04540  Gap junction
oor04611  Platelet activation
oor04713  Circadian entrainment
oor04714  Thermogenesis
oor04723  Retrograde endocannabinoid signaling
oor04724  Glutamatergic synapse
oor04725  Cholinergic synapse
oor04727  GABAergic synapse
oor04742  Taste transduction
oor04750  Inflammatory mediator regulation of TRP channels
oor04911  Insulin secretion
oor04912  GnRH signaling pathway
oor04913  Ovarian steroidogenesis
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04918  Thyroid hormone synthesis
oor04921  Oxytocin signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04925  Aldosterone synthesis and secretion
oor04926  Relaxin signaling pathway
oor04927  Cortisol synthesis and secretion
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor04970  Salivary secretion
oor04971  Gastric acid secretion
oor04972  Pancreatic secretion
oor04976  Bile secretion
oor05032  Morphine addiction
oor05163  Human cytomegalovirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05200  Pathways in cancer
oor05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101289858 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101289858 (ADCY4)
   04371 Apelin signaling pathway
    101289858 (ADCY4)
   04020 Calcium signaling pathway
    101289858 (ADCY4)
   04072 Phospholipase D signaling pathway
    101289858 (ADCY4)
   04024 cAMP signaling pathway
    101289858 (ADCY4)
   04022 cGMP-PKG signaling pathway
    101289858 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101289858 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101289858 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101289858 (ADCY4)
   04062 Chemokine signaling pathway
    101289858 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    101289858 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    101289858 (ADCY4)
   04912 GnRH signaling pathway
    101289858 (ADCY4)
   04913 Ovarian steroidogenesis
    101289858 (ADCY4)
   04915 Estrogen signaling pathway
    101289858 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    101289858 (ADCY4)
   04921 Oxytocin signaling pathway
    101289858 (ADCY4)
   04926 Relaxin signaling pathway
    101289858 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    101289858 (ADCY4)
   04918 Thyroid hormone synthesis
    101289858 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    101289858 (ADCY4)
   04916 Melanogenesis
    101289858 (ADCY4)
   04925 Aldosterone synthesis and secretion
    101289858 (ADCY4)
   04927 Cortisol synthesis and secretion
    101289858 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101289858 (ADCY4)
   04270 Vascular smooth muscle contraction
    101289858 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    101289858 (ADCY4)
   04971 Gastric acid secretion
    101289858 (ADCY4)
   04972 Pancreatic secretion
    101289858 (ADCY4)
   04976 Bile secretion
    101289858 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101289858 (ADCY4)
   04727 GABAergic synapse
    101289858 (ADCY4)
   04725 Cholinergic synapse
    101289858 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    101289858 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    101289858 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    101289858 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    101289858 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    101289858 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101289858 (ADCY4)
   04714 Thermogenesis
    101289858 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101289858 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    101289858 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101289858 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101289858 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101289858 (ADCY4)
   05163 Human cytomegalovirus infection
    101289858 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101289858 (ADCY4)
Enzymes [BR:oor01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101289858 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 101289858
NCBI-ProteinID: XP_004283168
Position
Unknown
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLVGLLALLAVAWASGRELASDPG
FLTTMLCGLGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGLGFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGLQPDSQPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAAMEHGDPYLRELGEPTYLVIDPRAEEEDEKGTAGRLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSEDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFFSNFI
IQMLVTNRPPALTITYSITFLLFFLLLFVCFSEHLTKCVLKGPKMLHWLPTLSVLVATRP
GLRVALGTATILLVFSMAITSLVFLPAASNCPFRAPNVSFTASNLSWELPGSLPLISVPY
SVHCCVLGFLSCSLFLHMSFELKLLLLLLWLAACCSLFLHSHAWLSDCLIARLYLGALDS
RPGVLKEPKLMGAIFFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAEQSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgcctcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctgctgctgctggtgatcgtgctcgtcggg
ctcctggcgctgctcgctgttgcctgggccagtggcagggagctggcctcagacccgggc
ttcctgaccactatgctgtgcgggctgggcggcttctcgctgctgctgggcctggcttcc
cgcgagcagcgactgcagcgctggacgcgtcccctgtcgggcctcgtgtgggcagcgctg
ctcgcgctaggcctcggcttcctcttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcaccgtgtacgccatgttgcccttgggcatgcgggac
gccgccgccgcgggtctcgcctcttcactctcacacctgctggtcctcgggctgtatctt
gggcttcagccggactcacagcccgcgctgctgccgcagctggcggcaaacgcggtgttg
ttcctgtgcgggaacgtggccggagcataccacaaggcgctgatggagcgcgcgctgcgc
gccacgttccgggaggcgcttagttccctgcactcccgccggagactcgacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gcggagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtaagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagtgagtgctcccctaaggagttggtgctcatgctaaacgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgccactctcgctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccaccggc
gtggatatcaacatgcgtgtgggtgtgcactcgggcagcgtgctctgcggggtcatcggg
ctgcagaagtggcagtatgatgtctggtcccatgatgtcactctggccaaccacatggag
gcgagtggagtgccaggacgagtacatatcacaggggctacgctggcactgctggcaggg
gcttatgctgtggaggatgcagccatggaacacggggacccataccttcgggagctaggg
gagccgacctaccttgtcatcgatccccgggctgaggaggaggacgagaagggcactgca
ggcaggttgctgtcctctcttgagggccccaagatgcgtccgtcactgctgatgacccgc
tacctggagtcctggggtgcggccaagccttttgcccacctgagccacgtggagagcccc
gtgtccacctccacccctctgccggagaaggccctgtcttccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgatgaactagacaccggggatgccaag
ttcttccaagtcattgaacagctcaactctcagaaacagtggaaacagtcagaggacttc
aacccattgacactgtacttccgagagaaggagatggagaaagagtatcggctctctgca
ctccccgccttcaaatactatgccgcctgcaccttcctggtttttttctccaacttcatt
atccagatgctggtgacaaacaggcccccagctctgaccatcacctatagcatcaccttc
ctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtcttg
aaaggccccaagatgctgcactggctgcccacactgtctgtcctagtggccacacggccc
ggactgcgagttgccctgggcaccgctaccatcctgctcgtcttctccatggccattacc
agcctggtcttcttaccggcagcatcaaactgccctttccgggctcccaatgtgtccttc
acggcttccaacctctcctgggagctccctgggtccctgcctctcatcagcgtcccctac
tccgtgcactgctgcgtgctggggttcctctcctgctccctcttcctgcacatgagcttc
gagctgaagctgctgctgctgctgctgtggctggcagcctgctgctccctcttcctgcac
tcccacgcctggctgtctgactgtctcatcgcccgcctctatctgggtgccttggactcc
aggccaggggtgctgaaggagcctaaactgatgggagcaatcttcttcttcatcttcttc
ttcaccctcctggtcctggctcggcagaatgagtattactgccgcctggacttcctgtgg
aagaagaagctgaggcaagagcaggaggagacagagacgatggaaaacctgactcggctg
ctcttggagaatgtgctccccgcgcacgtagccccccagttcatcggccagaatcggcgc
aacgaggacctctaccaccagtcctacgagtgtgtgtgtgtcctcttcgcctcagtccca
gacttcaaggagttttactctgaatccagcatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcctaagttcagtggg
gtggagaaaatcaaaactatctgcagcacctacatggcagctacaggcttgaacgccacc
tctggacaggacgcacagcaggatgccgagcaaagctgcagccaccttggcaccatggta
gagtttgccgtggcccttgggtctaagctggacgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtggggttaaaccacggacctgtagtggccggagtgattggggcccag
aaaccacaatatgacatctggggcaacacggtgaacgtggccagccgaatggagagcaca
ggcgtcctgggcaagatccaagtgaccgaagagacagcccgcgccctgcagtccttaggc
tacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggacctccctcggccaccctaggctga

DBGET integrated database retrieval system