KEGG   Oceanisphaera profunda: CBP31_02220Help
Entry
CBP31_02220       CDS       T04856                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
opf  Oceanisphaera profunda
Pathway
opf00520  Amino sugar and nucleotide sugar metabolism
opf01100  Metabolic pathways
opf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:opf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBP31_02220
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CBP31_02220
Enzymes [BR:opf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CBP31_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ART81590
UniProt: A0A1Y0D234
Position
complement(510993..511985)
Genome map
AA seq 330 aa AA seqDB search
MGPFILDLHSYELDGEERELLAHPTVGGVIFFSRNYHDKAQLAALVKSIRAVNPGLLLTV
DHEGGRVQRFRNEFFPLPAPGLLAQHNGKDRLSLLEDAGWLMAAELLALDIDLSFAPVLD
LERGSEVIGDRSFGQDPEQVIEHTGAYIKGMHNAGMAAVAKHFPGHGSVRADSHKESPID
ERDFHTIAELDMVPFKTLISQDLVQGIMPAHVIYAAVDANPAGFSEFWLKQVLRQQLGFK
GLIFSDDLTMEGAAVVGGYAQRAHSALQAGCDLLLACNHRKGAIEIIESLAHDLSCDFSA
LRGSAAKGGDIIRSAQWRAASERMQRFLDR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggcccctttattcttgatttgcacagttatgagctggacggtgaagagcgcgagctc
ttggcacacccaacggtaggtggcgtgatattttttagtcgtaattaccatgataaagcg
caactggcggccttagttaaatcgattcgtgccgtaaaccccggcttattactgacagtg
gatcatgaaggtgggcgcgtgcagcgctttcgcaatgagttttttcccctacctgctccc
ggcttgttggcgcagcacaacggcaaagaccgactatctctgctagaagacgcgggttgg
ttgatggcggctgaattattggcgctggatatcgacttaagttttgcaccagtgctggat
ttagaacgtggctctgaagttatcggcgatcgcagctttggccaagatcccgagcaggtg
attgagcatacgggtgcctacattaaaggcatgcacaatgctggcatggccgccgtagcc
aagcactttcctgggcacggcagtgtgcgggccgactctcataaagaaagcccgatagat
gaacgggactttcacaccatagctgagcttgatatggtgccgtttaagactttaattagc
caagatttggtacaaggcatcatgccagcccatgtgatttacgcagcggtagacgctaac
ccagcaggtttttctgagttttggcttaagcaagtgttacgccagcaattgggctttaaa
ggcttaatctttagtgatgacttaaccatggaaggcgcggcagtggtgggcggctatgca
caacgtgcgcacagtgcgttacaggcaggttgcgacttattgctggcttgtaatcaccgc
aaaggcgccattgagatcatcgaatctttagctcatgatttgagctgcgatttttctgca
ttacgcgggtctgcagctaaaggtggcgatataatacgcagtgcacaatggcgcgcggcc
agtgagcggatgcaacgtttccttgatcgctag

DBGET integrated database retrieval system