KEGG   Oceanisphaera profunda: CBP31_04645Help
Entry
CBP31_04645       CDS       T04856                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
opf  Oceanisphaera profunda
Pathway
opf00071  Fatty acid degradation
opf00072  Synthesis and degradation of ketone bodies
opf00280  Valine, leucine and isoleucine degradation
opf00310  Lysine degradation
opf00362  Benzoate degradation
opf00380  Tryptophan metabolism
opf00620  Pyruvate metabolism
opf00630  Glyoxylate and dicarboxylate metabolism
opf00640  Propanoate metabolism
opf00650  Butanoate metabolism
opf00900  Terpenoid backbone biosynthesis
opf01100  Metabolic pathways
opf01110  Biosynthesis of secondary metabolites
opf01120  Microbial metabolism in diverse environments
opf01130  Biosynthesis of antibiotics
opf01200  Carbon metabolism
opf01212  Fatty acid metabolism
opf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:opf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP31_04645
   00630 Glyoxylate and dicarboxylate metabolism
    CBP31_04645
   00640 Propanoate metabolism
    CBP31_04645
   00650 Butanoate metabolism
    CBP31_04645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBP31_04645
   00072 Synthesis and degradation of ketone bodies
    CBP31_04645
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBP31_04645
   00310 Lysine degradation
    CBP31_04645
   00380 Tryptophan metabolism
    CBP31_04645
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP31_04645
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP31_04645
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBP31_04645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:opf04147]
    CBP31_04645
Enzymes [BR:opf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBP31_04645
Exosome [BR:opf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP31_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ART83940
UniProt: A0A1Y0D8N8
Position
complement(1066873..1068069)
Genome map
AA seq 398 aa AA seqDB search
MKKEHIVIVGAARTPMGALLGELGTVSAPQLGAAAMAAAIARAGLEPQQIDEVMMGCVLS
AGLGQAPARQAALAAGLPSSVPCTTINKMCGSGMKAVMLAWDQLTAGSTELMVAGGMESM
SQAPYLLPKARAGLRLGHASLLDHLFFDGLEDAYEGGLMGSFAQRTADQFAISRTAMDEF
ALLSLSRAQRAIAEGDFAAEITPVKVETRQGSSVANNMVSIDQQPGLARPEKIPKLKPAF
SKDGTITAANSSSISDGAAALVLTTSSHAQVLGVTPLARVLAHATHAQLPAEFTLAPIGA
IKKLLNKVGWQADEVDLYEINEAFAVVTLLAVAELELDINKVNVNGGACALGHPIGASGA
RIMVTLMHALRQRGLKKGVAALCIGGGEATAIAVELIE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagcatatcgtcatagtcggcgcggcgcgcacccccatgggcgccttgctg
ggtgagcttggcacagtgtcggcgcctcagttgggcgcggctgcgatggcggcggcaatt
gcgcgtgcagggctagagccgcaacagatagatgaagtcatgatgggctgcgtgttatcc
gccggccttggccaagcaccggcccgccaagccgctttagccgcagggctccccagtagc
gtgccgtgcaccactatcaataaaatgtgtggttctgggatgaaggcggtgatgttggcc
tgggatcaacttacagcaggcagtacagagctaatggtggcaggcggcatggagagcatg
agccaagccccttacttattgcctaaggctcgagccggtttgcgtttagggcacgccagt
ttgttggatcatctattttttgatggcttagaagatgcctatgagggcggcttaatgggc
agttttgctcagcgcaccgccgatcaatttgctataagtcgcaccgccatggatgagttt
gcgctgttgtcattaagtcgtgctcaaagagcgatagcggagggcgactttgccgctgaa
attacccccgttaaggtcgagacccgccaaggatcctctgtggctaacaacatggtcagt
atcgaccagcaaccgggccttgctcgacccgagaagatacccaagctcaaacctgccttt
agcaaagacggcaccattaccgccgctaattccagctccatttctgacggcgccgccgcc
ttggtgctgaccactagcagtcatgcccaagtgctcggtgttacgccgttggcacgcgtg
ctggcccatgctacgcatgcccagttgccagcagagtttactctggcacccattggcgcc
attaaaaagctgcttaacaaagtcggctggcaagcggatgaagtggatttatatgagatt
aatgaagcctttgccgtggtgaccttattggcggtggcggagctggagttagacataaat
aaggtcaacgttaacggcggagcctgcgctttgggccaccctattggcgccagtggggcg
cgtattatggtgaccttaatgcatgcgctgcgccaacgcggtttaaaaaaaggcgtggcg
gcgctgtgcattggcggcggtgaggccacggccatagcggtagagctaatcgagtaa

DBGET integrated database retrieval system