KEGG   Oceanisphaera profunda: CBP31_05095Help
Entry
CBP31_05095       CDS       T04856                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
opf  Oceanisphaera profunda
Brite
KEGG Orthology (KO) [BR:opf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CBP31_05095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF3935
Motif
Other DBs
NCBI-ProteinID: ART82075
UniProt: A0A1Y0D4P2
Position
1177375..1178640
Genome map
AA seq 421 aa AA seqDB search
MDIIANYGTLLILIAAAFGFFMAWGIGANDVANAMGTSVGTRSLTIKQAILIAMVFEFAG
AYLAGGEVTSTIRNGIIDSEAFADHPDLLVFGMIASLLASGTWLLVASYYGWPVSTTHTI
IGAIVGFALVSLGSSAVHWSKVGGIVGSWVVTPAISGLMAYFIFISVQRLIFNADKPLAA
AKKYVPAYIFMTVMVICLVTLQKGLKHVGLDMSNTESFVLATLISLASALLCGVYIKRKQ
YDSEDDKDMQYTNVEKVFGILMVVTACAMAFAHGSNDVANAIGPLSAVVSIVQSSGEIAA
KSSIAWWILPLGGVGIVIGLASLGHKVMATVGTGITHLTPSRGFAAQLATAATVVIASGT
GLPISTTQTLVGAVMGVGLARGIAALNLNVLRNIVVSWVITLPAGAILAIIFFYIIQWSF
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggatatcattgctaactacggcactctgcttattttaatagcagccgcctttggcttt
tttatggcttggggtataggtgccaacgatgtggcgaacgccatgggcacatctgtgggt
acgcgctcactgaccatcaagcaggcgattcttatcgccatggtttttgagttcgccggt
gcttacttggcgggcggtgaagtaacctccaccattcgtaacggcatcatagactcagaa
gcctttgccgatcacccagatttgctggtgtttggtatgatcgcctcactattagcctcg
ggtacttggctattagtggcttcttactatggctggccggtatcaaccacgcacaccatc
ataggtgccatcgtaggcttcgcactggtgtcattaggttcgagtgccgtgcactggagt
aaggtgggcggcatcgtcggctcttgggtagtcacgccggctatctcggggttaatggcc
tactttatctttatcagcgtgcaacggcttattttcaacgccgacaagccgctggcggcc
gctaagaaatacgtccccgcttatatctttatgacggtgatggtgatttgtttggtcacc
ctgcaaaagggcctaaagcacgtcggccttgatatgagcaacaccgaaagctttgtgctg
gcgacgctgatttctttggcttcagccctgttgtgtggcgtttacatcaaacgtaaacaa
tacgacagtgaagacgacaaagacatgcagtacaccaacgtagaaaaggtgtttggcatc
ttaatggtggttaccgcttgtgccatggcttttgcgcacggttcaaacgacgtagccaat
gctattggtccgttatcggcggtagtgagcatagtacaaagctctggcgaaattgccgcg
aaatccagtattgcttggtggattttaccactgggcggcgtgggtatcgtcatcggcctg
gcctctttaggccacaaggtaatggccaccgtagggacgggtattacacacctgacgcct
agccgaggttttgccgctcagttagccacggctgcgacagtggtgatcgcatccggtact
ggcttgccaatttctactacccagaccctagtgggcgcggtaatgggcgtaggcttagca
cgcggtattgcggcactaaacctgaacgtactgcgtaacatagtggtttcttgggtaatt
actttgcccgcaggcgctattttagccattattttcttctatattattcaatggtctttt
agctaa

DBGET integrated database retrieval system