KEGG   Obesumbacterium proteus: DSM2777_06955
Entry
DSM2777_06955     CDS       T04310                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
opo  Obesumbacterium proteus
Pathway
opo00230  Purine metabolism
opo01100  Metabolic pathways
opo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DSM2777_06955
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AMO80809
Position
complement(1500983..1501459)
AA seq 158 aa
MNRKHWVDIECEINGKRYPFTISPALSLMELLRDEGLTSVKQGCGVGECGACTVLIDGVA
TDSCLYLAVWADGKCIRTAEGEVKNGRLSQVQQAYVDAGAVQCGFCTPSLVMATTALLAK
HPSRPLTHEEIRRGLAGNLCRCTGYQMVIRAVEACSDS
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaaccgtaagcattgggttgatattgaatgtgaaataaacgggaagcgttaccccttt
acgatttctcccgcgctgtcgttgatggagcttcttagagatgaagggctaacgagcgtg
aaacagggctgcggtgtaggagaatgtggcgcctgcaccgtgcttatcgacggcgtcgca
accgatagctgtttatatctcgccgtatgggccgatggaaaatgcatccgcaccgccgaa
ggcgaggtcaaaaatggccgactctctcaggtacagcaggcctacgttgatgccggagcc
gtacagtgtggtttctgcacgccgagtctggtaatggcaaccacggcgctgctcgccaag
catccgtcccgcccgttaactcatgaagaaattcgtcgtggattagctggaaacctatgc
cgctgcactggctatcaaatggtgatccgtgcggtagaagcctgtagtgatagctaa

DBGET integrated database retrieval system