KEGG   Obesumbacterium proteus: DSM2777_06965
Entry
DSM2777_06965     CDS       T04310                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
opo  Obesumbacterium proteus
Pathway
opo00230  Purine metabolism
opo01100  Metabolic pathways
opo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DSM2777_06965
Enzymes [BR:opo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DSM2777_06965
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AMO80811
Position
complement(1502337..1504622)
AA seq 761 aa
MSLGSPLKRVDAEAKVTGHARYTDDHQMHGMRYAKYVRSPLAHAYVTAIDTYAALALPGV
EAVFTYQDVPELRFPTAGHAWSLEPAKRDVADRQLLTQHVRHYGDGVAIVVARDALTAER
AAALVEVVYQELPVIATAQGALAPDAPLIHPEGNTLKKSEISANQPKEAISSADFQLSAH
FQTPVIQHCHMEGVTCFAYMEQPDHIVIVSSTQIPQIVRRTVAQALGMPWSNIRVIKPYI
GGGFGNKQDVLEEPMAAFLTQKMGGIPVKVELSREECFFASRTRHAFSIDAELGLNHDGI
LTGYQLNVLSNTGAYASHGHSIASAGANKISYLYPRSAFGYSALTHYSNYPAAGAMRGYG
APQVAFALECLLDDAAEKLSLDAVDVRLLNAARSGDINPVNHKKIYSAGLVECLEKGREL
FEWNARKAACKNQTGDLRRGVGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGATE
IGQGSDTVFAQMAAETLGIPFEHIRVISTQDTDITAYDPGAFASRQSYVAAPAVMQAASE
LRSKILAHAELISHQPQWGLTLLNGNVVMAAQPEMVLMSVAEVSMHAYYHQEIGAQLLAE
ISHKTTTNPPAFGCTFVDLSVDIPLCKVTINKIINLHDSGRILNPQLAEGQVHGGMGMGI
GWALFEEMIIDEKTGVVRNPNLLDYKFPTIMDLPDLDCAFVETYEPQSAYGHKALGEPPI
ISPAPAIRNAIRMATGVSINTLPITPKTLFAEFVQAGLIRE
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgtcgttaggatccccactcaagcgggtggacgctgaagcaaaggttaccggccacgct
cgctataccgacgatcatcaaatgcacggcatgcgttacgccaaatatgtacgtagccct
ctcgcccatgcctatgtcacggccattgatacttatgcggcactggctttgcccggtgtt
gaagccgtatttacttatcaggacgtacctgaattacgatttcccaccgcaggacatgct
tggtcgttggagcccgctaaacgagacgttgccgatcgtcagctactcacccaacatgtg
cgccattatggcgatggagtcgcgattgtggtcgcacgtgatgcgctaaccgcagaacgt
gccgccgcgctggttgaagtggtatatcaagagctgccggtgatagccaccgcacagggc
gctttagcaccagacgcaccgctcattcatccagaaggcaatacgctgaaaaaaagtgaa
atcagcgctaaccagcctaaagaagcaatctcatcggctgattttcagctctccgcgcat
tttcaaacaccggtgatccagcactgtcatatggaaggcgtgacctgttttgcctatatg
gaacagccagatcatattgtgattgtctccagcacccagatcccgcagatcgtgcgccgc
acggtcgctcaagctctgggtatgccgtggtcaaacatacgcgtgatcaaaccttatatc
ggcggtggcttcggcaataaacaggacgtactcgaagagccgatggccgcctttctcacc
caaaagatgggcggtattccggtgaaggtcgaactcagccgcgaagaatgcttttttgct
tcccgcacgcgtcatgccttcagtatcgacgcggaactgggacttaatcacgacggtatt
ttaacgggctatcagttaaacgtgctgtcgaacaccggtgcttatgcttcgcacgggcat
tccatcgcctccgccggtgccaacaaaatcagctatctctatccccgtagcgccttcggc
tattcggctctcacgcattattcgaactatcccgccgcaggtgctatgcgcggttatggc
gcaccgcaggtggcttttgcactggaatgtttattagatgacgcggcagaaaagctgtct
ctcgacgccgtcgatgtgcgtttgctgaatgcggcacgcagcggtgatatcaatccggtt
aaccacaaaaagatttatagcgcggggcttgttgaatgccttgagaaaggacgcgaactg
ttcgaatggaacgcccgtaaggccgcctgtaaaaatcaaacaggcgatctgcgccgcggc
gtcggcgtcgcatgttttagctacggctctaatacctaccctgttggcgttgaaattgcg
ggagcccgcatgttgctcaaccaagacggcacggtaaatctgcaaattggcgccacagag
atcggccaaggttcagataccgttttcgcccagatggccgctgaaacgctaggtattccc
tttgaacatattcgcgtgatatccacccaagacaccgatatcacggcctacgaccccggc
gcatttgcgtctcgacagagctatgttgccgcgcctgcggtgatgcaggcggcaagcgaa
ttacgcagtaaaatactggctcatgctgaattaattagtcaccagccgcagtggggactc
acattactcaacggaaatgtggtgatggcggcgcaacctgaaatggtgctcatgagcgtg
gcggaggtttcgatgcatgcttattatcatcaggaaatcggagcccagctgctggctgaa
atatcccataaaaccaccactaacccaccggcttttggctgcacgtttgtcgatctcagc
gtcgatattccactgtgcaaagtcaccatcaacaagattatcaacctgcatgactcaggc
cgaatccttaacccacagcttgccgaaggccaagtgcatggcggaatgggcatggggatc
ggctgggctttatttgaagagatgatcattgatgaaaaaaccggcgtggtccgtaatcca
aacctgctggattataaattccccaccattatggatctgcccgatctggattgcgcattt
gttgaaacctatgagccccagtctgcctacgggcacaaggcgctcggcgaaccaccgatt
atctcgcccgctcccgcaattagaaacgctattcgtatggcaaccggcgtctccatcaac
acgctgcccatcacgcctaaaacgctgtttgcggaattcgttcaggccggactcatcagg
gagtaa

DBGET integrated database retrieval system