KEGG   Obesumbacterium proteus: DSM2777_07645Help
Entry
DSM2777_07645     CDS       T04310                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
opo  Obesumbacterium proteus
Pathway
opo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:opo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DSM2777_07645 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:opo03400]
    DSM2777_07645 (recB)
Enzymes [BR:opo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DSM2777_07645 (recB)
DNA repair and recombination proteins [BR:opo03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DSM2777_07645 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_11 AAA_25
Motif
Other DBs
NCBI-ProteinID: AMO80931
Position
1662268..1665825
Genome map
AA seq 1185 aa AA seqDB search
MTQAQTLDALALPLIGERLIEASAGTGKTFTIAALYLRLLLGLGGENAFPRPLSVEEILV
VTFTEAATEELRGRIRSNIHDLRLACVRGSSTNPLLSDLLDLIDDKTDAVSQLLAAERQM
DEAAIYTIHGFCQRMLSNNAFESGILFQQTLVQDELPLRRQACADFWRRHCYPLPLNIAA
VVSQEWSGPEQLLSDLQPYLHGELPELRQVIADDETLAQRHQQIIERIDAVKSQWRAAAG
EIESLIADSGVDKRSYSSRYLPKWLAAVGDWSAAETLDYQLPDELKRFGQNILLEKTKKG
TPPQHAVFVAIDQLLVEPLSLRDLLLSRALSEVRTSVQQEKRQHAQLGFDDLLSRLSQAL
QQPGGEMLAQAIRQRYPVAMIDEFQDTDPQQYGIFQAIYFQTERAQQSDSALLLIGDPKQ
AIYAFRGADIFTYMYARSEVKHHYTLGTNWRSSPGMVAAVNQVFSTIASPFLFEDIPFLP
VEAAKNNQALRFEIEGQRQQAMHIWLQSGEGCGTVEYQQSLATQCAAQIRDWLTAGQQGK
ALLYSNKNQPKPVEASDITILVRSRAEAALIRDALSALAIPSVYLSNRDNVFETPEARDL
LWLLQAVLAPEQERLLRSALATSLMGLNSQQINHFNQDERLWDALVDEFDGYRQRWQKQG
VLPMLREIMVSRNLAENLLASEGGERRLTDVLHIGELLQEASLTLDSEPALLRWLAQQID
NPAVQSENQQLRLESDRHLVQVVTIHKSKGLEFPIVWLPFIGSYRLQKQPLYHDRDNFKA
VLDLNYNDDAVKLAEEERLAEDLRLLYVALTRSVYHCSLGLAPLFLGGRKKQGETDVHNS
AIGYLLQKGEPGDAGLLLECLQRLQNDDIVVTPVSSEDTSPWVPNAPEAQDLQAKLFTRK
MQDDWRVTSYSGLQQHSSTPFFDLLPKLDVDAVGESDIETTPELTPHTFPKGAAPGTFLH
SLLEPLDFTQPRDLEWLSEQVTLQGLDDQWVPVLDRWLEAILRAQLAETGPCLAQLPPSQ
IQAELQFYLPIEQLLKSAELDALIKRYDPLSAQCDPLDFRQVRGMLKGFIDLVFFWQGRY
YVLDYKSNWLGADENAYTPEAMAGAMAEHRYDFQYQLYSLALHRYLRHRLPDYQYEQHFG
GVFYCFLRGMSPDKPGQGVFHCRPDVALIEGMDKLFSSASEDATC
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcacaaacgttagatgctttggcgctgccgctgattggggagcgcctgatt
gaggcctcagccggtacaggtaaaacatttaccatcgcggcgctgtatctgcgtttgctg
ttggggctgggaggcgagaatgcttttcctcgccccctgtccgtagaagaaattctggtt
gtgacctttaccgaagcggcgaccgaagagctgcgtgggcgcattcgtagcaatatccac
gatctacggctggcctgcgtgcgtggcagtagcaccaatccgctgttgtctgatttgctc
gatcttatcgatgataaaaccgatgcggtaagccaattattagcggcagagcgccaaatg
gacgaagccgctatttataccatccacggtttttgtcagcgaatgctcagcaacaatgcc
tttgagtctggcattctgttccagcaaaccttggttcaggatgagctaccgctgcgccgc
caagcctgcgccgatttttggcgtcggcactgttatccgttgccgctgaatattgcggcg
gtggtgagccaagagtggagcggtcctgaacagctgctgagtgatttacagccctatctg
catggggagctgcccgaattacgccaagtgattgccgatgacgaaacgctggctcagcga
caccagcaaattattgagcgcattgatgccgtgaaatcccagtggcgcgcagccgctggc
gaaattgaaagcctgatcgcggattccggcgtagacaaacgcagctacagcagccgttat
ctacctaaatggctagctgcggttggcgactggtcggccgccgagacgctggattatcaa
ttacccgatgagctcaaacgttttggccagaacatcctgttggaaaagaccaagaaaggt
acgcccccacagcatgccgtgtttgtcgcgatcgatcagctactggttgaaccgttgtcc
ctgcgtgacttgctgttatcgcgtgccttaagcgaagttcgcaccagcgttcagcaggaa
aagcgccagcatgcgcagttaggctttgatgatttgctcagccgcctttcacaggcgtta
cagcaacccggtggtgagatgctggctcaggcgatccgccagcgttatcccgtggcgatg
atcgatgagtttcaagataccgatccccagcaatatggcatcttccaagcgatctatttc
cagacagagcgcgcccagcaatcagactcggcgctgttgctgattggcgatcctaaacag
gctatttacgcttttcgcggtgcagacatttttacctacatgtatgcgcgtagcgaagtg
aaacatcattatacgctgggcactaactggcgctcatcgcccggtatggtggcagcggtc
aatcaggttttctccacgattgcatccccttttcttttcgaagatattccgtttttgccg
gttgaagcggctaaaaataaccaggcgctgcgttttgaaattgaagggcagcgtcagcaa
gccatgcatatttggctgcaatccggcgaaggctgcggcaccgttgaatatcaacagtca
ttggcaacacagtgtgcggcccaaattcgcgattggctgacggcggggcagcagggcaaa
gcattgctctactccaataaaaatcagccgaaacccgtagaagcatcagacatcaccatt
ctggtgcgcagccgcgctgaagcggcgttaattcgtgatgcgctgagcgcgctggcgatc
ccttctgtctatttatctaaccgtgacaacgtttttgaaacgccggaagcgcgcgatttg
ctgtggctcttgcaagccgtgctggctccagaacaggaacgactgttgcgcagcgctctg
gcaaccagtttgatggggctgaactcgcagcagattaaccatttcaatcaggacgagcgc
ttgtgggatgcgctggttgatgaattcgatggttatcgtcagcgctggcaaaagcagggt
gtattgcccatgctgcgtgaaatcatggtgagcagaaatctggccgagaatctgttggcc
agtgagggcggtgaacgacgcctaacggatgtgctacacatcggtgaactgttgcaggaa
gcgtcgctaacgctagatagcgaaccggcattgctgcgttggttagcgcagcaaattgat
aatcccgcggtgcagtcggaaaaccagcagcttcgtttagaaagcgatcgccatttagtg
caggtggtgaccatccataaatcgaaagggctcgagtttccgatagtgtggctgccattt
attggcagttatcggctgcaaaaacagccgttgtatcacgacagagataatttcaaagcg
gtgctcgatcttaactataacgatgatgcggttaagctggcggaagaagagcgcttggcg
gaagacttacgcctgctctatgttgcgctcacccgttctgtttatcactgtagcctcggg
ctggctcctctgtttttaggtggtcgaaaaaaacagggtgaaactgacgtgcataacagc
gccatcggatacctgctacaaaaaggtgagcccggtgatgccgggttgctgttggagtgt
ctccagcgcctacaaaatgacgatatcgtggtgacgcctgtttccagtgaggatacctca
ccgtgggtgcctaatgctcctgaagcacaggatcttcaagccaagttgtttacccgtaag
atgcaagatgactggcgtgtcaccagttattcagggttacagcagcacagcagcacgccg
tttttcgacttgctgcctaaacttgatgtggatgcggtgggggaatctgatattgaaacc
acgccagagctcacaccgcatacgttccctaaaggtgcggcaccggggacctttttacat
agtttattagaaccgttggatttcactcagccacgcgatcttgaatggctgagcgagcag
gtgactctgcaaggattggatgaccagtgggttcctgtactcgatcgttggctagaggct
attttacgcgcccagttagctgaaactgggccctgtttagcgcagcttccaccaagccaa
attcaggccgaactacagttttatttgccgattgaacagctgctaaagagcgctgaactg
gatgccctgattaaacgttatgatccactttccgctcagtgcgatccgttagatttccgt
caggttcgcggcatgttgaaaggctttatcgacttagtctttttctggcaagggcgctat
tacgtgttggattataagtccaattggttaggtgccgacgaaaatgcctatacaccagag
gcgatggcgggggcgatggcagaacaccgctacgatttccaataccagctttactcattg
gcgctgcatcgctatttgcgccatcggctgcctgattaccaatacgagcagcatttcggc
ggcgttttctactgcttcctacgcgggatgtcgccagataaaccggggcagggtgttttt
cattgtcgtccagatgtcgcgctcattgagggaatggataagctctttagttccgcctcg
gaggacgcaacatgctga

DBGET integrated database retrieval system