KEGG   Obesumbacterium proteus: DSM2777_07745Help
Entry
DSM2777_07745     CDS       T04310                                 

Definition
(GenBank) tRNA pseudouridine synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
opo  Obesumbacterium proteus
Brite
KEGG Orthology (KO) [BR:opo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:opo03016]
    DSM2777_07745
Enzymes [BR:opo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     DSM2777_07745
Transfer RNA biogenesis [BR:opo03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    DSM2777_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AMO80945
Position
1683895..1684689
Genome map
AA seq 264 aa AA seqDB search
MLNIIYQDEHLVAVNKPAGWLVHRSWLDRHETVFVMQTLRDQIGQHVFPVHRLDRPTSGV
LLMALSSDVARMLSEQFEQREMNKTYHAVVRGYLEGEAVIDYALTPELDKIADKFADPDK
APQTAVSHYRSLATVEMPVAVGKYQTARYSLVELKPETGRKHQLRRHMSHLRHPIIGDTK
HGDLRQNRAMAQHFSCSGLMLHASELCLGHPVTGEPLCLQAGLDDRWQRMMSHFGWQSYL
PYLERVEFPESCVHDNQNDVSVNS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatattatctatcaggatgaacatctggttgcggtgaataagccggcgggctgg
ctggttcaccgtagctggcttgaccgtcatgaaaccgtgtttgtcatgcaaacgctgcgc
gatcagattggtcagcatgtgtttccggtacatcgcctcgatcgcccaacgtctggcgtg
ctactgatggcgctttccagcgacgttgcccgcatgctgtcggaacagtttgagcagcgt
gagatgaataagacctatcatgcggtggtacgcggctaccttgaaggggaagcggtaatt
gattatgcgttaacgccagagctggacaagattgctgataagtttgccgatcctgataaa
gcgccacagacggcggtgagtcattaccgttcgttagcaacggttgaaatgccggttgcc
gttggtaagtaccaaaccgcacgttacagtctggtagagttaaagccagaaaccggtcgt
aagcatcagctacgccgtcatatgtcacatttacgccatccgattattggcgataccaaa
cacggcgacctgcgccaaaatcgcgccatggcgcagcatttctcttgctctggtttgatg
ctgcatgcgagcgagttgtgtctcggtcatccggtgaccggagagccgctctgtttgcag
gctgggcttgacgatcgctggcaacgcatgatgtcgcactttggctggcaaagttatctc
ccttatcttgaaagggttgagtttccagagagttgcgttcacgataaccaaaatgacgtc
agcgtaaattcttaa

DBGET integrated database retrieval system