KEGG   Obesumbacterium proteus: DSM2777_07930Help
Entry
DSM2777_07930     CDS       T04310                                 

Definition
(GenBank) L-threonine dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
opo  Obesumbacterium proteus
Pathway
opo00010  Glycolysis / Gluconeogenesis
opo00071  Fatty acid degradation
opo00350  Tyrosine metabolism
opo00625  Chloroalkane and chloroalkene degradation
opo00626  Naphthalene degradation
opo01100  Metabolic pathways
opo01110  Biosynthesis of secondary metabolites
opo01120  Microbial metabolism in diverse environments
opo01130  Biosynthesis of antibiotics
opo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSM2777_07930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DSM2777_07930
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DSM2777_07930
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSM2777_07930
   00626 Naphthalene degradation
    DSM2777_07930
Enzymes [BR:opo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DSM2777_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Lamprin
Motif
Other DBs
NCBI-ProteinID: AMO80976
UniProt: A0A4Q9D4E0
Position
complement(1724646..1725797)
Genome map
AA seq 383 aa AA seqDB search
MTTSTFFIPSVNMIGAGCLAEAATTMKGYGYKHALIVTDNVLNKIGVVAKVQALLSDMSI
KSAVYDGTHPNPTTINVAEGLEILRQHQSDCVISLGGGSPHDCAKGIALVAANGGDIRDY
EGVDQSAKPQLPLISINTTAGTASEMTRFCIITDVDRHIKMAIVDKHVTPILSVNDPELM
AGMPKGLTAATGMDALTHAVEAYVSIAANPITDACALKAVTMISQSLRHAVENGNNMEAR
ETMAYAQFLAGMAFNNASLGYVHAMAHQLGGFYDLPHGVCNAVLLPHVQIFNAKVSAARL
KDIAAAMGVDVSKMNDQQGADACIAEIRKLAKDVNIPAGLTELNVKEEDLPTLATNALKD
ACGFTNPIQATHEEIVAIFKAAM
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttcaaccttctttatcccttcagtcaatatgatcggcgctggctgcttagcc
gaagcggcaaccaccatgaaaggctatggctacaagcatgcgctgattgttaccgacaac
gtattgaacaaaatcggtgttgtcgccaaagttcaggctttgctatctgatatgagtatt
aagagcgcggtgtatgatggtacccatccaaacccaacgacgatcaacgtcgctgaaggc
ttagaaattctgcgccagcatcaaagtgactgtgttatttcccttggcggtggttctcca
cacgattgcgcaaaaggcattgcactggtcgctgccaacggaggtgacatccgtgattac
gaaggtgttgatcaatctgctaaaccacagttaccgctgatttctatcaataccactgcg
ggtacagcgtctgaaatgacccgtttctgcatcattaccgacgttgatcgccacatcaaa
atggccatcgtggataaacacgtcacgccaattctgtcagtgaacgatcctgagctgatg
gccggtatgcctaaaggcctgaccgcagcgaccggtatggatgcgctgacccatgccgta
gaagcctacgtgtctatcgccgctaacccaatcacagatgcctgcgcgctgaaagccgtc
accatgatcagccaatcgctgcgtcatgcggtggaaaacggcaacaacatggaagcgcgt
gaaaccatggcttatgcacagttcttggccggtatggcatttaacaacgcatcactgggc
tatgtgcacgccatggcgcaccagttgggtggtttctacgatttgccacacggcgtgtgt
aatgcggttctgctgccacacgtgcagatctttaacgcgaaagtgtctgctgctcgcctg
aaagatatcgccgcggcgatgggcgttgatgtgagcaagatgaatgaccagcaaggtgcg
gatgcgtgtatcgcagaaatccgtaaactggcaaaagacgtcaacattcctgccggtttg
accgaactgaacgtgaaagaagaagatctgccaacgctggcaaccaatgccttgaaagat
gcctgtggtttcactaacccaattcaggctacgcacgaagagatcgtcgctatctttaaa
gccgcaatgtaa

DBGET integrated database retrieval system