KEGG   Obesumbacterium proteus: DSM2777_09130Help
Entry
DSM2777_09130     CDS       T04310                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
opo  Obesumbacterium proteus
Pathway
opo00903  Limonene and pinene degradation
opo00930  Caprolactam degradation
opo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DSM2777_09130
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    DSM2777_09130
Enzymes [BR:opo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     DSM2777_09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Hydrolase_4 COesterase AXE1 Abhydrolase_2 BAAT_C PSD2 Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AMO81188
Position
complement(1960467..1961372)
Genome map
AA seq 301 aa AA seqDB search
MRSFKSHLFKYAIKRHFAQADLDDVATMRKQMDELGERLPLAQGTRLKSVEPSGIYAEWL
IPSHAHSDAAILYLHGGAYHMGSCSSHRSMASYIADAANIPLLLADYRLAPESPYPAALN
DAETVYRWLLTQSNINPKRIFVMGDSAGGGLALALTLRIKSDSALPLPAGVAVLSPWTDL
SMSGESVKTRLTRDPFFAHHLHHAERCVNAYSGVAALTDPGVSPLFGDLSRFPPLLIQVG
SEEILYSDAERFAQKAASAGVDVHLSRWQGMWHVWQYLVPRMKESRMAITEIGDFCRTQL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagctttaaaagtcatctgtttaagtatgctattaagcgacattttgcgcaggcc
gatctagacgatgtggcgactatgcgtaaacaaatggatgaattgggtgagcgacttcct
ctcgctcagggaacgcgccttaaaagcgttgagccatccggcatttatgctgaatggctt
atcccatcccacgcacattcagatgccgcaattctctatttgcacggtggcgcctatcat
atgggatcctgttccagccacagatcgatggcgtcatatatagcggatgccgccaacatc
cctttattgttggccgattatcgcttagcgcccgaatccccttaccccgccgcgctcaat
gatgctgaaactgtttatcgttggttgctgactcaatctaacattaaccccaagcgcatt
tttgtgatgggtgattccgccggtggtggattagccttggcgctaacactgcggataaaa
tccgattcggcgcttcctcttcccgcaggcgttgccgttttaagcccttggaccgacctg
tcgatgagtggtgaatcagtgaaaacacgcctgacgcgcgatcctttctttgcacaccat
cttcaccacgccgagcgctgtgtaaacgcgtacagtggcgttgccgcgttgaccgacccg
ggcgtttctccattattcggtgatttgtcgaggtttccaccgttattgattcaggtggga
agtgaagagattctgtatagcgatgccgaacgtttcgcccaaaaagcggcaagcgcgggc
gttgacgtacacttatctcgttggcagggaatgtggcatgtttggcaatatctggtgccg
cgcatgaaagagtcacgcatggccattaccgagattggtgatttctgtcgtacacagctt
aaataa

DBGET integrated database retrieval system