KEGG   Obesumbacterium proteus: DSM2777_15730Help
Entry
DSM2777_15730     CDS       T04310                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
opo  Obesumbacterium proteus
Brite
KEGG Orthology (KO) [BR:opo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:opo03009]
    DSM2777_15730
Enzymes [BR:opo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     DSM2777_15730
Ribosome biogenesis [BR:opo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DSM2777_15730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_4 MTS Methyltransf_32 Methyltransf_29 Ubie_methyltran Methyltransf_9 Methyltransf_2 Pox_MCEL MetW PCMT CMAS DUF2315 DREV CheR TPMT
Motif
Other DBs
NCBI-ProteinID: AMO82351
Position
3300730..3301542
Genome map
AA seq 270 aa AA seqDB search
MPYQCPLCQQPLEKNDHQWRCANNHQFDCAKEGYVNLMPVQHKHSKQPGDSTEMMQARRA
FLDQNYYQPLRDAVCQAIKAHMAPQTRRILDIGCGEGYYTSEVAKQFSEQDIAVFGLDIA
KVAIRYAAKRYPTVSFCVASSHRLPYADASMDAVVRIYAPCKAEELARVIAPEGILVTVS
PAPRHLYQLKEQVYDTVQLHAENTESFEGFTLIDDQQLAYTMMLPGEQAANLLQMTPFAW
RATPDVAETLKNRTEFECETDFAIRVYRRD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccttatcagtgtcctctttgccagcaaccgctggaaaaaaacgatcatcagtggcgt
tgtgccaataaccaccagtttgattgtgcaaaagagggatacgtaaatctgatgcctgtt
cagcacaaacactccaagcagccgggagacagtactgaaatgatgcaggcacggcgtgca
tttttggatcagaactactatcagccgctgcgtgacgccgtttgtcaggcaattaaggcg
catatggcgcctcaaacccgtcgtattctcgatattggctgcggagagggatattacacc
tctgaagtggcaaaacagtttagcgagcaggatattgcggttttcggtctggatatcgcg
aaggttgccattcgctatgcggcgaagcgctatccaacggtgtcattctgtgtcgcctca
agccatcgtttgccttacgccgatgcgtcgatggatgctgtggttcgaatctacgcacct
tgcaaggctgaggagctggcccgcgttattgctccagaaggcattcttgtgacagtgtca
ccggctccgcgccatctctaccagctcaaagagcaagtttatgacacggtgcagttgcac
gcagaaaacacagagtcgtttgaagggtttacgctcatcgatgatcaacaactggcgtac
accatgatgttgccgggagagcaggccgctaatttactgcaaatgacaccgtttgcttgg
cgggcaacgcctgatgtggctgaaacattgaaaaacagaacagaatttgagtgtgaaacc
gattttgctattcgtgtgtatcgccgtgattaa

DBGET integrated database retrieval system