KEGG   Obesumbacterium proteus: DSM2777_20940Help
Entry
DSM2777_20940     CDS       T04310                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
opo  Obesumbacterium proteus
Pathway
opo00860  Porphyrin and chlorophyll metabolism
opo01100  Metabolic pathways
opo01110  Biosynthesis of secondary metabolites
opo01120  Microbial metabolism in diverse environments
Module
opo_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
opo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DSM2777_20940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:opo01007]
    DSM2777_20940
Enzymes [BR:opo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DSM2777_20940
Amino acid related enzymes [BR:opo01007]
 Aminotransferase (transaminase)
  Class III
   DSM2777_20940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMO83297
Position
4463936..4465222
Genome map
AA seq 428 aa AA seqDB search
MSKSESLYAQAKELIPGGVNSPVRAFTGVGGVPLFIERADGAYLYDADGKAYIDYVGSWG
PMVLGHNHPAIREAVLEAVSRGLSFGAPTEMEVKMAELVTTLVPSMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADHLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDIESVLQAFKQYPDDIACIIVEPVAGNMNCIPPQPEFLPGLRELCDQYGALLIIDEVM
TGFRVALAGAQDYYGVTPDLTCLGKIIGGGMPVGAFGGRRDVMEALAPTGPVYQAGTLSG
NPVAMAAGFACLNEISQPGIYPQLTELTDNLASGLLDAAQKEDIPLVVNHVGGMFGIFFT
DQETVTCYQDVTRCDVERFKQFFHLMLEEGVYFAPSAFEAGFMSLAHSQEDIQKTIDAAR
RCFVKMKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaagtctgtacgctcaggcaaaagagctaattccgggtggcgttaac
tccccggttcgcgccttcaccggcgttggtggtgtgcctttattcattgagcgcgcagat
ggcgcttacctgtacgatgccgatggcaaagcctacattgattacgttggctcatggggg
ccaatggttctcggccacaaccatccagcgattcgcgaagccgtgctagaggcagttagc
cgtggcttaagctttggcgcaccaaccgaaatggaagtcaaaatggccgaactggtcacc
acgctggtgccaagcatggacatggtgcgtatggtgaactcaggtacagaagccaccatg
agcgccatccgtctggctcgtggctttaccggccgcgataagatcatcaagttcgaaggt
tgctaccacggccacgccgatcacctgctggtgaaagcgggctcgggtgccctcacctta
ggccagccaaactctccgggcgttccggctgactttgctaaacatacgctgacctgcacc
tataacgatatcgaatccgttttacaggcgttcaagcaataccctgacgacatcgcctgc
atcatcgttgagccggtagcaggaaacatgaactgtattcctccacagcctgaattcctg
ccaggtttacgtgagctatgcgaccaatacggcgcgttgctaattattgatgaagtgatg
acaggcttccgcgttgcgttggctggtgctcaggattattacggcgtgacgccggaccta
acctgcttaggcaaaatcatcggcggcggtatgcccgttggcgcattcggcggtcgccgt
gatgtgatggaagcactggcacccaccggccctgtttatcaagccggtacgctatcaggt
aaccctgtcgcgatggccgcgggcttcgcctgtctcaacgagatctctcagccgggcatc
tatccacagttgaccgaactcaccgacaatctcgcttccggcctgttagatgctgcgcaa
aaagaagacattccacttgtagtgaatcacgtgggcggcatgtttgggattttcttcacc
gatcaggaaaccgttacctgctatcaggacgtgacgcgttgcgacgtcgaacgattcaag
cagttcttccatttgatgctggaagaaggcgtgtacttcgctccttctgcgtttgaagcc
ggctttatgtcgctggcgcattcacaggaagatattcagaaaaccatcgatgccgcgcgt
cgttgttttgtgaagatgaagaaatag

DBGET integrated database retrieval system