KEGG   Oceanithermus profundus: Ocepr_0484Help
Entry
Ocepr_0484        CDS       T01369                                 

Definition
(GenBank) cytochrome c biogenesis protein transmembrane region
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD LMBR1
Motif
Other DBs
NCBI-ProteinID: ADR35943
UniProt: E4U670
Position
486617..487471
Genome map
AA seq 284 aa AA seqDB search
MGTRKSARKGSAGRGRLWLGAAGLLLLFAAGVYLAVARPFGMPGVVWLEAHPLLAFGLSG
VAGFADGLNPCAITTLLLFIGALMAVVERAARVGEAWRAHLYVWSVAGAYILGIFLLYFV
LGAGFIEVTSLRVFGNTHVFTRIAALLAVLLGLTMVWEYFQPHSPIRLTMPAGLHGLARK
WGRRTTVAAAFVGGVLIGTCTIPCGGAMYLAVASLIGSLPSKPYAYGLLLTYNLAFVLPL
LLLVGASGSRTVLRELSRLHVTQRGKVKLGLGLFVVLVGLFALS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggcacacggaagagcgcacgtaaggggagcgcggggcgcgggcggctgtggcttggg
gctgcggggctgttgctgcttttcgccgccggggtctacctggcggtcgcccggcccttc
ggcatgcccggcgtcgtctggctcgaggcccaccccctgctcgccttcgggctttccggg
gtcgcgggcttcgccgacggcctcaacccctgcgcgatcaccacgttgctcctcttcatc
ggggcgttgatggccgtggtggagcgcgcggcgcgggtgggcgaggcctggcgggcccac
ctgtacgtgtggtccgtcgccggggcttacatcctcggcatctttctgctctacttcgtc
cttggcgcaggcttcatcgaggtcaccagcctgcgggtcttcggcaacacccacgtcttc
acccggattgcggccctgctggcggtgctcttgggcctgaccatggtgtgggagtatttc
cagccccattcgcctatccggctgacgatgccggccggcctgcacgggcttgccaggaag
tgggggcgcaggaccaccgttgcggcggcgttcgtgggcggggtgttgatcggaacctgc
accatcccctgcggcggcgcgatgtacctggcggtggcctcgctcatcggaagccttccg
tcgaagccgtacgcgtacggccttctgctcacctacaacctcgcgttcgtcctgcccctc
ctgctgctcgtcggcgcgagcggcagccgcacggtgctcagggaactttcccggctgcac
gttacgcagcgggggaaggtcaaactcggccttggcctcttcgtggtcctggtcggcttg
ttcgcgctgtcgtga

DBGET integrated database retrieval system