KEGG   Oceanithermus profundus: Ocepr_0495Help
Entry
Ocepr_0495        CDS       T01369                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
opr  Oceanithermus profundus
Pathway
opr00010  Glycolysis / Gluconeogenesis
opr00020  Citrate cycle (TCA cycle)
opr00620  Pyruvate metabolism
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01120  Microbial metabolism in diverse environments
opr01130  Biosynthesis of antibiotics
opr01200  Carbon metabolism
Module
opr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ocepr_0495
   00020 Citrate cycle (TCA cycle)
    Ocepr_0495
   00620 Pyruvate metabolism
    Ocepr_0495
Enzymes [BR:opr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Ocepr_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP DUF4914
Motif
Other DBs
NCBI-ProteinID: ADR35954
UniProt: E4U681
Position
complement(499352..500938)
Genome map
AA seq 528 aa AA seqDB search
MRDLRVHGIHPKGQVFWDTPTPVLVEHALARQQGQLAHKGPLVVDTTPYTGRSPRDKFIV
REPSSDADIWWGEVNQPFAPEAFDDLYERVAAHLSERDLYVQDLYAGANPKHRLAVRVIT
ESPWHAHFARNMFILPRRFQRDDEIEPFMPEFTVVHAPSFKAVPERDGTRSEVFVLVHFA
KRIVLIGGTHYGGEIKKSIFSVLNYLMPKQGVLSMHCSANLGRRGDAAIFFGLSGTGKTT
LSTDPDRPLIGDDEHGWSEEGVFNFEGGCYAKVINLTPESEPLVYRATMMFESILENVVV
NPSSRRPEFDDGSKTENTRSSYPLAHLDNVVTSSMGPHPENIFFLSADAFGVLPPIARLT
PEQAMYYFISGYTAKVAGTERGVTEPVATFSACFGAPFLPLHPARYAEMLRDRIQKFGPR
VWMVNTGWTGGPYGVGKRMALAHTRALLSAALEGKLDDVPYVEDPIFGFQVPTEAPGVPH
ELLVPKQTWPDPGAYDEAARKLARMFQENFAKYADGAGEEVRNAGPRV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatttacgggttcacggcattcaccccaagggtcaggttttctgggacaccccc
acccccgtgctggtcgagcacgcgctggccagacagcagggccagctcgcccacaagggc
ccgctcgtggtcgacaccaccccctacaccggacgcagtccgcgggacaagttcatcgtc
cgcgaacccagcagcgacgcggacatctggtggggcgaggtcaaccagcccttcgcgccc
gaggccttcgacgacctgtacgaacgcgtggcggcgcacctttcggagcgcgacctctac
gtacaggacctctacgccggcgccaaccccaagcaccgcctggccgtgcgggtgatcacc
gagagcccctggcacgctcacttcgcccgcaacatgttcatcctgccgcggcgcttccag
cgcgacgacgagatcgaacccttcatgcccgagttcacggtggtgcacgcgcccagcttc
aaggcggtgcccgagcgcgacggcacccgcagcgaggtcttcgtgctcgtgcatttcgcc
aagcgcatcgtgctcatcggcggcacccactacggcggggagatcaagaagtcgatcttc
tcggtgctcaactacctgatgcccaagcagggcgtgctctcgatgcactgctcagccaac
ctgggccgccgcggcgacgccgcgatcttcttcggcctctcgggcacgggcaagaccacc
ctctccaccgatcccgaccgccctttgatcggcgacgacgaacacggctggtcggaagaa
ggcgtcttcaacttcgaaggcggctgctacgcgaaggtgattaacctcacccccgaatcc
gagccgctcgtctaccgggccacgatgatgttcgaaagcatcctcgagaacgtcgtggtg
aacccgagcagccgcaggcccgagttcgacgacggttccaagaccgagaacacccgctcc
tcctacccgctcgcccacctggacaacgtcgtcaccagcagcatggggccccaccccgag
aacatcttcttcctctcggccgacgccttcggcgtgctgccgccgatcgcgcggctcacc
ccggagcaggcgatgtactacttcatcagcggctacaccgccaaggtagccggcaccgaa
cgcggcgtcaccgagcccgtggccaccttctcggcctgcttcggcgcgcccttcctgccg
ctgcacccggcgcgctacgccgagatgctgcgcgaccggatccagaagttcggcccccgc
gtctggatggtaaacaccggctggaccggcgggccctacggcgtgggcaagcggatggcg
ctcgcgcacacccgggcgctcctcagcgcggcgctcgagggcaagctcgacgacgttccc
tacgtcgaagacccgatcttcggcttccaggtccccaccgaggcccctggggtgccccac
gaactgctcgtccccaaacaaacctggcccgatcctggagcctacgacgaggccgcccgc
aagctggcccggatgttccaggaaaacttcgccaagtacgccgacggcgccggcgaagag
gtgcgaaacgccggaccgcgggtctga

DBGET integrated database retrieval system