KEGG   Oceanithermus profundus: Ocepr_0498Help
Entry
Ocepr_0498        CDS       T01369                                 

Definition
(GenBank) heat shock protein, protease HtpX
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADR35957
UniProt: E4U684
Position
complement(502721..502954)
Genome map
AA seq 77 aa AA seqDB search
MIRLVANAYEILIEIMMWVVLILGALQGYAVGPSFLGLVFGLLLALLFDVVVFGTLVILL
EIRNDLRKIAQRTAPTL
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgatacggctggtagcgaacgcgtacgagatcctgatcgaaatcatgatgtgggtcgtc
ctgatcctgggggcgctgcagggttacgccgtcgggccgagcttccttgggctggtgttc
gggctcctgctcgccctgctcttcgacgtcgtcgtctttggcacactggtgatcctgctg
gagatccgcaacgacctccggaagatcgcgcagcgcaccgccccgaccctttga

DBGET integrated database retrieval system