KEGG   Oceanithermus profundus: Ocepr_0501Help
Entry
Ocepr_0501        CDS       T01369                                 

Definition
(GenBank) LAO/AO transport system ATPase
  KO
K07588  LAO/AO transport system kinase [EC:2.7.-.-]
Organism
opr  Oceanithermus profundus
Brite
KEGG Orthology (KO) [BR:opr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ocepr_0501
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     Ocepr_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MeaB cobW GTP_EFTU AAA_30 RsgA_GTPase NTPase_1 Zeta_toxin ABC_tran ATP_bind_1 AAA_16 CbiA AAA_22 TrwB_AAD_bind AAA_18 AAA_33 MobB AAA_5 MMR_HSR1 KTI12 APS_kinase AAA_29 ATPase Mg_chelatase NACHT PIF1 AAA_24 RNA_helicase AAA_28 AAA_19 CoaE PRK NB-ARC
Motif
Other DBs
NCBI-ProteinID: ADR35960
UniProt: E4U687
Position
complement(504946..505887)
Genome map
AA seq 313 aa AA seqDB search
MDVVRAFHERDRRALARALTWVESGLPEGEALLKAARGQGHAKVVGLTGSPGAGKSTLAD
RLIEAVRGRGETVAVLAVDPSSPFTGGAILGDRIRMMRHHKDEGVFIRSMASRGSLGGLA
GATVAALALLEAFGFDWVFLETVGVGQSEVDIARVADTTVLVLTPAAGDAVQAFKAGVME
IADLIVVNKFDLPGGERVVQELKATLEFAPPRPAGWQVPVLTTVAQSGQGTEELLEAIEA
HHEHLERHGLLEPHRIERARFEIASVIQALGQESARKSDALVREVAAGRLSPREAAGRLV
AHALEAPDQGGES
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtacgcgcctttcacgaaagggaccggcgcgccctggcgcgcgcgctgacc
tgggtcgagtcgggcctgcccgaaggcgaggcgctgctcaaggcggcgcgcggccagggg
cacgccaaggtggtgggcctcaccggcagccccggcgccggcaagagcacgctggccgac
cgcctcatcgaggccgtgcgcggccgcggcgaaaccgtggccgtgctcgccgtggacccc
agttcgcccttcaccggcggcgccatcctgggcgaccgcatccgcatgatgcgccaccac
aaggacgaaggcgtcttcatccgttcgatggcgagccgcggctcgctgggcgggttggcg
ggggccaccgtcgcggcgctcgcgctgctcgaggccttcggcttcgactgggtcttcctc
gagaccgtgggcgtgggccagagcgaggtggacatcgcccgggtggccgacaccacggtg
ctggtgctcacccccgccgccggcgacgcggtgcaggccttcaaggccggggtgatggag
atcgccgacttgatcgtggtcaacaagttcgacctgcccggcggcgagcgggtggtccag
gagctcaaggctaccctcgagttcgccccgccccgccccgcgggctggcaggtgccggtg
ctcaccaccgtggcccagtcgggccagggaaccgaggagctgctcgaggccatcgaggcc
caccacgaacacctcgagcggcacggcctgctcgaaccccaccgcatcgagcgcgcccgc
ttcgagatcgccagcgtcatccaggccctgggccaggagagcgcccgcaagagcgacgcg
ctggtgcgcgaggtggccgcgggccggctcagcccccgcgaggccgcgggccggctagtg
gcgcacgcgctcgaggcgccggaccagggtggcgagtcctga

DBGET integrated database retrieval system