KEGG   Oceanithermus profundus: Ocepr_0508Help
Entry
Ocepr_0508        CDS       T01369                                 

Definition
(GenBank) PfkB domain protein
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
opr  Oceanithermus profundus
Pathway
opr00051  Fructose and mannose metabolism
opr00500  Starch and sucrose metabolism
opr00520  Amino sugar and nucleotide sugar metabolism
opr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ocepr_0508
   00500 Starch and sucrose metabolism
    Ocepr_0508
   00520 Amino sugar and nucleotide sugar metabolism
    Ocepr_0508
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     Ocepr_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: ADR35967
UniProt: E4U6W4
Position
511270..512181
Genome map
AA seq 303 aa AA seqDB search
MIAVLGEALVDLLPAERPGLWRARAGGSPANVALGLGRLGVPARFYGGLSRDGWGRWIRD
RLRAAGVEAAGPFSEDPTPLARVEAGAAEEARYRFYLRGTAFEAAGWPQAGEGVRAVHAG
SLAAALPPAADEVWGWLERLEGAFVSFDPNVRPGLTPAAFRGVFWERLDRFDLVKLSAAD
LDWLAAGEDRDAALARLRAAVPWVVLTLGAGGAVGFCGAHEVHVPPPRVRVVDTVGAGDA
FTAGLLAWAEAAGVFGGAPLDRAGLTAALVFACRVAGLTLERVGADPPTRKELEARGGEV
CGA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggttctgggcgaggcgctggtcgacctgctgccggccgagcggccggggctg
tggcgggcgcgtgccggcggctcgccggccaacgtggccctggggctggggcggctgggc
gttcccgcccgtttctacggcgggctttcccgcgacggctggggccgctggatccgagac
cgattgcgtgcggccggggtggaggcggccgggcccttcagcgaagaccccacgccgctc
gcgcgggtggaggcgggggcggcggaagaggcgcgctaccgcttctacctgcggggcacg
gcgttcgaggccgcgggctggccgcaggccggagagggcgtacgcgcggtgcacgccggt
tcgctggcggcggccttgccgccggcggcggacgaggtgtgggggtggctcgagcgcctg
gaaggcgccttcgtgagcttcgatcccaacgttcgtcccggcctgacgcccgcggcgttc
cgcggggtcttctgggaacggctggaccgcttcgacctggtcaagctgagtgccgcggac
ctggattggctggccgcgggcgaggaccgggacgccgccctggcgcggctgcgcgcggcg
gtgccctgggtggtgctcaccctgggggcgggcggcgcggtggggttttgcggagcgcac
gaggtgcacgtaccgcccccgcgggtgcgggtggtggacacggtgggcgccggcgacgcc
ttcaccgcgggcctcctcgcctgggcggaggccgccggggtcttcggcggcgcgccgctg
gaccgggcggggctcactgcggccttggtcttcgcctgccgggtggcggggctgacgctc
gagcgcgtcggggccgacccgccgacacgtaaggagctggaagcgagagggggcgaggta
tgcggagcgtga

DBGET integrated database retrieval system