KEGG   Oceanithermus profundus: Ocepr_0517Help
Entry
Ocepr_0517        CDS       T01369                                 

Definition
(GenBank) hypothetical protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADR35975
UniProt: E4U6X2
Position
524434..524667
Genome map
AA seq 77 aa AA seqDB search
MDALIGLPVLPVVLSVDLVVCLAVRPALAKGLEGTRRFGAEQKTGAPREDDGVRKPLRGY
RAGSLIRRRTRLLDICK
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttgattgggctgccggtgctgccggtcgtcctgtccgtcgacctcgtggtc
tgccttgcggttcgcccggcgctcgcgaaagggctggagggcacccggcggttcggtgct
gagcagaagaccggcgcgccgcgcgaagacgacggcgtgcgcaagccgcttcgcggatac
cgcgcgggttctttgatccgccggcgaacccgcctgcttgacatatgtaagtaa

DBGET integrated database retrieval system