KEGG   Oceanithermus profundus: Ocepr_0520Help
Entry
Ocepr_0520        CDS       T01369                                 

Definition
(GenBank) ABC-2 type transporter
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane LapA_dom ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ADR35978
UniProt: E4U6X5
Position
complement(527597..528370)
Genome map
AA seq 257 aa AA seqDB search
MLRVIAVEFKRSLLMLRRYPMEMVGQLIVITMIFYGLFLGAQYIAGPTAQFGDRLDALVV
GYVLWTLALFAIGDLSWGLMNEAREGTLEQVFLSPFGPGRVYMARNVAGLLLTLGLNLSI
LGLIMLLTGVRLDFSWSALAPLAAVLLGAYGLGFLLGALALLFKRIQAFLNLFQFVLMFL
IMTPFEQLHGLFRFAGYLLPMTTGAGQLRALMARGEAFDPVVFGLGLLNGFVYLIVGLWV
FGRAVRAAKERGLLGGY
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggtgatcgccgtcgagttcaaacgcagcctgctgatgctgcggcgctacccc
atggagatggtggggcagctgatcgtgatcacgatgatcttctacggcctcttcctgggg
gcgcagtacatcgccggccccacggcgcagttcggggaccgcctggacgcgctggtcgtg
ggttacgtcctctggacgctggccctcttcgccatcggcgacctcagctgggggctgatg
aacgaggcgcgcgagggcaccctcgagcaggtcttcctcagccccttcggccccgggcgc
gtctacatggcccgcaacgtcgccgggctgctcctcaccctcggcctcaacctgagcatc
ctggggttgatcatgctcctcaccggcgtgcggctcgacttctcctggtcggcgctggcg
ccgctggccgcggtgctcctcggcgcctacgggctgggcttcctgctcggcgcgctcgcg
ctcctcttcaagcgcatccaggccttcctcaacctgttccagttcgtgttgatgttcctg
atcatgaccccgttcgagcagctgcacggcctcttccgcttcgccggctacctgctgccc
atgaccaccggggcggggcagctgcgggcgctgatggcgcgcggcgaggccttcgacccg
gtcgtcttcggcctgggcctgctgaacggtttcgtctacctgatcgtggggctctgggtc
ttcggacgcgccgtgcgcgcggccaaggagcgtgggttgctggggggatactga

DBGET integrated database retrieval system