KEGG   Oceanithermus profundus: Ocepr_0532Help
Entry
Ocepr_0532        CDS       T01369                                 

Definition
(GenBank) Type II secretion system F domain
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF ExoD DUF3236
Motif
Other DBs
NCBI-ProteinID: ADR35990
UniProt: E4U6Y7
Position
536834..538033
Genome map
AA seq 399 aa AA seqDB search
MRYLYLASDESGTRTAEGVIEAENLQEARRRLREMGLFPLRLAPAGRRRRHRRPGSGDLV
LFMEQFATLIGAGVSLVQALHTLSLQSPHPTLRHAAQQVRSRVEGGAGLAEAMGEFPEAF
PPIVVRMVAAAELSGSLEETLRRVARYLDDAFELQQKIRSALTYPFFAITIVLLAVVALL
VVVVPVFQKLYAGAGAELPGITLALLAVSDAVRRYAPLILLGAVLLVWAFRRWRATPTGG
YLIDRALLGLPVFGPIAHKSGLARFARTLATLYASGINILAALDAARDLAGNRYVAALID
EVQDRIAKGESLSQALSHEPEVFVPMFTRMVSIGEESGELDRMLDQVGHHLEREVDHTTK
RLSGMIEPVMTVVLGVIVLFVALALYLPLFELPGKVMGR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacctctacctggccagcgacgagagcggaacccgcaccgccgagggcgtgatc
gaggccgagaacctgcaggaggcccgccgccgcctgcgcgagatgggcctcttcccgctg
cgcctggcgcccgccggacgccgccgccgccaccggaggccgggcagcggcgatctggtg
ctcttcatggaacagttcgccaccctgatcggggcgggggtgagcctggtgcaggcgctg
cacaccctcagcctgcaaagcccccaccccacgttgcgccacgccgcccagcaggtgcgc
agccgggtcgaggggggcgcggggctggccgaggccatgggggagttccccgaggccttc
cccccgatcgtggtgcgcatggtcgccgcggccgagctgagcggctccctcgaggagacg
ctgcgccgcgtcgcgcgctacctggacgacgccttcgagctgcagcagaagatccgttcg
gcgctcacctatccgttcttcgcgatcacgattgtgctcctcgcggtggtggcgctgctc
gtggtggtcgtgcccgtctttcagaagctctacgccggcgccggcgccgagctcccgggg
atcaccctggcgctgctcgccgtttccgacgccgtccgccgctacgcgccgctcattctc
ctcggcgccgtccttctggtctgggccttccggcggtggcgcgccacccccaccggcggc
tacctcatcgaccgcgcgctcctggggctgcccgtcttcgggccgatcgcacacaagagc
gggctcgcccgttttgcccgcaccctggccaccctctacgccagcggcatcaacatcctg
gcggccctcgacgccgcgcgcgacctggccggcaaccgctacgtcgccgcgctgatcgac
gaggtgcaggaccgcatcgccaagggcgagtcgctctcgcaggcgctctcgcacgagccc
gaggtcttcgtccccatgttcacccgcatggtgagcatcggcgaggagtcgggcgagctc
gaccgcatgctcgaccaggtggggcaccacctcgaacgcgaggtggaccacaccacgaag
cggctctccggcatgatcgagccggtcatgacggtggtcctgggcgtgatcgtcctcttc
gtggcactcgccctctacctgccgctcttcgagctcccgggtaaggtgatgggccgatga

DBGET integrated database retrieval system