KEGG   Oceanithermus profundus: Ocepr_0568Help
Entry
Ocepr_0568        CDS       T01369                                 

Definition
(GenBank) bacterial nucleoid protein Hbs
  KO
K03530  DNA-binding protein HU-beta
Organism
opr  Oceanithermus profundus
Brite
KEGG Orthology (KO) [BR:opr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:opr03032]
    Ocepr_0568
   03036 Chromosome and associated proteins [BR:opr03036]
    Ocepr_0568
   03400 DNA repair and recombination proteins [BR:opr03400]
    Ocepr_0568
DNA replication proteins [BR:opr03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Ocepr_0568
Chromosome and associated proteins [BR:opr03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HU (heat unstable protein)
    Ocepr_0568
DNA repair and recombination proteins [BR:opr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      Ocepr_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 CDC37_M DUF4777
Motif
Other DBs
NCBI-ProteinID: ADR36026
UniProt: E4U723
Position
complement(568868..569164)
Genome map
AA seq 98 aa AA seqDB search
MANKKKTVTKSDLVNHVAEITGLKKKDAKACIDTFLDEIATFLDRDYKVQLTGFGTFEVR
KRKARTGVKPGTTEKIKIPASKYPAFKPGKALKEKVRV
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaagaagaagacggttacgaaatcggatctggtcaaccacgtcgccgagatc
accgggctgaagaagaaggacgcgaaggcctgcatcgataccttcctcgacgagatcgcc
accttcctcgaccgcgactacaaggtgcagctcaccggcttcgggaccttcgaggtgcgc
aagcgcaaggcccgcaccggcgtgaagcccggcaccaccgagaagatcaagatccccgcc
tccaagtacccggccttcaaacccggcaaggcgctgaaggaaaaagtccgcgtataa

DBGET integrated database retrieval system