KEGG   Oceanithermus profundus: Ocepr_0568Help
Entry
Ocepr_0568        CDS       T01369                                 

Definition
(GenBank) bacterial nucleoid protein Hbs
  KO
K03530  DNA-binding protein HU-beta
Organism
opr  Oceanithermus profundus
Brite
DNA replication proteins [BR:opr03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Ocepr_0568
Chromosome and associated proteins [BR:opr03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HU (heat unstable protein)
    Ocepr_0568
DNA repair and recombination proteins [BR:opr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      Ocepr_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding DUF4496 CDC37_M DUF4777
Motif
Other DBs
NCBI-ProteinID: ADR36026
UniProt: E4U723
Position
complement(568868..569164)
Genome map
AA seq 98 aa AA seqDB search
MANKKKTVTKSDLVNHVAEITGLKKKDAKACIDTFLDEIATFLDRDYKVQLTGFGTFEVR
KRKARTGVKPGTTEKIKIPASKYPAFKPGKALKEKVRV
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaagaagaagacggttacgaaatcggatctggtcaaccacgtcgccgagatc
accgggctgaagaagaaggacgcgaaggcctgcatcgataccttcctcgacgagatcgcc
accttcctcgaccgcgactacaaggtgcagctcaccggcttcgggaccttcgaggtgcgc
aagcgcaaggcccgcaccggcgtgaagcccggcaccaccgagaagatcaagatccccgcc
tccaagtacccggccttcaaacccggcaaggcgctgaaggaaaaagtccgcgtataa

DBGET integrated database retrieval system