KEGG   Oceanithermus profundus: Ocepr_0584Help
Entry
Ocepr_0584        CDS       T01369                                 

Definition
(GenBank) periplasmic nitrate reductase subunit NapH
  KO
K02574  ferredoxin-type protein NapH
Organism
opr  Oceanithermus profundus
Brite
KEGG Orthology (KO) [BR:opr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Ocepr_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_5 Fer4_7 Fer4_9 Fer4_10 Fer4 Fer4_6 Fer4_21 Fer4_3 Fer4_2 Fer4_4 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADR36042
UniProt: E4U739
Position
584416..585234
Genome map
AA seq 272 aa AA seqDB search
MKSRLRYVYDHYRFLILRRTLQLGILLLFFGANAWGWSLLVGDLSSSRILNTVPLADPLA
VLQLLLAGGALAGQVLVGALIVLVAYALIGRAFCSWVCPVNLITDLAEWVRNRLGFREPP
LMYLNRNLRYVVLAMVLVLSLLLSLPVFEFVSPIAAASRGVAFGMGMGWALLLAIFLFDL
FVVRHGYCGHICPLGAFYSLTSRFRRVRVRHEKDSCTLCGLCFNACPEPHVLNLIGKHDG
TVNNPECTNCFRCVEVCDDDALFVSLSGGWSK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaggctgcgctacgtctacgaccactaccgcttcctcatcctgcggcgtacg
ttgcagctgggcatcttgctgctcttcttcggcgccaacgcctggggctggagcctgctc
gtgggcgacctgagcagctcgcggatcctgaacacggtgccgctcgccgatccgctggcg
gtgctgcagctcctgctcgcgggcggcgcgctcgccggccaggtgctcgtgggggcgttg
atcgtgctcgtggcctatgcgctgatcggccgggcgttctgttcctgggtctgtccggtg
aacctgatcaccgacctggccgagtgggtgcggaaccgcctgggctttcgcgagccgccg
ctgatgtacctcaaccgcaacctgcgctacgtcgtgctcgcgatggtgctggtgctgagc
ctgctgctctcgctgccggtcttcgagttcgtgagcccgatcgccgcggcgtcgcgcggc
gtcgccttcggcatgggcatggggtgggcgctgctgctcgcgatcttcctcttcgacctc
ttcgtggtgcgccacggctactgcggccacatctgcccgctgggcgcgttctacagcctc
acctcgcgcttccgcagggtgcgcgtgcgccacgagaaggacagctgcaccctgtgcggg
ctttgcttcaacgcctgccccgaaccccacgtgctgaacctgatcggcaagcacgacggc
acggtcaacaaccccgagtgcaccaactgcttccgctgcgtcgaggtctgcgacgacgac
gccctgttcgtgagcctgagtggaggatggtcaaaatga

DBGET integrated database retrieval system