KEGG   Oceanithermus profundus: Ocepr_0597Help
Entry
Ocepr_0597        CDS       T01369                                 

Definition
(GenBank) hypothetical protein
Organism
opr  Oceanithermus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_P460 Paired_CXXCH_1
Motif
Other DBs
NCBI-ProteinID: ADR36055
UniProt: E4U752
Position
595138..595602
Genome map
AA seq 154 aa AA seqDB search
MKRWTTVLAAALALAAAAQTNPTAAELWSWLLDQNFAERWQHVPGEPAGKHAGGPPHGAI
QQIFANDVAFEALAQKRFPLPDGAVIVKENYDAQGRLYNLAVMRKVKGYNPEGGDWFWGY
FTPEGGVLFEGKPALCVGCHAQKKASDWIFSGQE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatggacgacggtgctggccgcggccctggcgctcgcggccgcggcgcagacg
aaccctacggcagcggagctctggagctggcttctcgaccagaacttcgccgaacgctgg
cagcacgttcccggcgagcccgcgggcaagcacgcgggcggcccacctcacggcgcgatt
cagcagatcttcgcgaacgacgtcgccttcgaggcgctcgcccagaagcgctttccgctg
cccgacggggcggtgatcgtcaaggagaactacgacgcacaggggcggctctacaacctg
gcggtgatgcgcaaggtgaaggggtacaaccccgagggcggcgactggttctggggctac
ttcacgcccgaaggcggggtgctcttcgaggggaagccggcgctctgtgtcggctgccac
gcccagaagaaggcctcggactggatcttcagcggtcaagaatga

DBGET integrated database retrieval system