KEGG   Oceanithermus profundus: Ocepr_0599Help
Entry
Ocepr_0599        CDS       T01369                                 

Definition
(GenBank) Peptidylprolyl isomerase
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
opr  Oceanithermus profundus
Brite
Enzymes [BR:opr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Ocepr_0599
Chaperones and folding catalysts [BR:opr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    Ocepr_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: ADR36057
UniProt: E4U754
Position
complement(596193..596663)
Genome map
AA seq 156 aa AA seqDB search
MNASKDKVVTIAYTLTVDGETVDQGELAYIHGHQQIIPGLEKEIEGRAAGESFEVTVAPE
EAYGERNEEGVQVVPRSAFPDDAKVEVGEQFYAQDDQGNPLPLTVTKVEGEDVTVDFNHP
LAGKTLNFAVEVKEVRDATPEELAHGHVHGSGGHHH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagcaaagacaaagtggtcacgatcgcctacaccctcaccgtcgacggcgag
acggtggaccagggcgagctggcctacatccacggacaccagcagatcatccccggcctc
gagaaggagatcgagggccgcgcagcaggcgagtcgttcgaggtgaccgtagcccccgag
gaggcctacggcgaacgcaacgaggaaggcgtgcaggtcgtaccccgctcggccttcccc
gacgacgccaaggtcgaggtgggcgagcagttctacgcccaggacgaccagggcaaccct
ctgcccctcaccgtcaccaaggtcgagggcgaggacgtcaccgtcgacttcaaccacccc
ctcgccggcaagaccctgaacttcgcggtcgaggtcaaggaagtgcgcgacgccaccccc
gaagagctggcgcacggccacgtccacggttccggcggccaccaccactaa

DBGET integrated database retrieval system