KEGG   Oceanithermus profundus: Ocepr_0600Help
Entry
Ocepr_0600        CDS       T01369                                 

Definition
(GenBank) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
opr  Oceanithermus profundus
Pathway
opr00270  Cysteine and methionine metabolism
opr00920  Sulfur metabolism
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01120  Microbial metabolism in diverse environments
opr01130  Biosynthesis of antibiotics
opr01200  Carbon metabolism
opr01230  Biosynthesis of amino acids
Module
opr_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Ocepr_0600
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Ocepr_0600
Enzymes [BR:opr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Ocepr_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADR36058
UniProt: E4U755
Position
596772..597683
Genome map
AA seq 303 aa AA seqDB search
MELEHAIGNTPMVRLRRLTEGGAEVWVKLEGANPGGSIKDRAAWGMVRGAEERGELRPGS
GQWIVEATSGNTGIGLAMIAAARGYRYLNVSTEGLSPERRAILRAYGAELEFVPSAEGMR
GARERARRIAEENGAWWADQFANPDNPRAHERGTGPEIWRQTQGRVDALVWGTGTGGTIS
GCARYLKAKNPDLLVVALEPATHQAIAGGPLEGHAFQGMGPGFVPENLDLSLVDEVWPVP
RDPAFELGRRLWREEGLLLGLSSMANLWAALRLAQRLGPDKRVVTLSADSGLKYLNVAPY
ADA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgagcacgcgatcgggaacacaccgatggtgcggttgcggcggctcaccgag
ggtggggccgaggtctgggtcaagctggagggggcgaaccccgggggctcgatcaaggac
cgcgccgcctgggggatggtccgcggcgccgaggaacgcggcgaactgcggcccggaagc
ggccagtggatcgtcgaggccacctccgggaacaccgggatcggcctcgccatgatcgcc
gccgcccgcggctaccgctacctcaacgtctccaccgagggcctctcgcccgagcggcgg
gccatcctgcgggcctacggcgccgagctggagttcgtgccctcggccgagggcatgcgc
ggcgcccgcgagcgggcgcgccggatcgcggaggagaacggggcctggtgggccgaccag
ttcgccaaccccgacaacccccgcgcccacgaacgcggcaccgggcccgagatctggcgt
cagacgcagggacgggtggacgcgctcgtctgggggacgggcaccgggggcacgatctcc
ggctgcgcccgctacctgaaggccaagaaccccgatctgctcgtggtggcgctcgagccc
gccacccatcaggcgatcgccggcgggccgctcgaggggcacgcctttcaggggatgggg
ccggggttcgttcccgagaacctggacctgagcctcgtcgacgaggtctggccggtgccg
cgggaccccgccttcgagctgggccggcggctttggcgcgaggagggactgctcctcggc
ctcagctccatggccaacctctgggccgcgttgcggctcgcccagcgtctgggccccgac
aagcgcgtggtcacgctctcggccgactcgggcctcaagtacctgaacgtcgccccgtac
gcggacgcctaa

DBGET integrated database retrieval system