KEGG   Oceanithermus profundus: Ocepr_0603Help
Entry
Ocepr_0603        CDS       T01369                                 

Definition
(GenBank) carbohydrate ABC transporter substrate-binding protein, CUT1 family
  KO
K15770  arabinogalactan oligomer / maltooligosaccharide transport system substrate-binding protein
Organism
opr  Oceanithermus profundus
Pathway
opr02010  ABC transporters
Module
opr_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:opr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ocepr_0603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:opr02000]
    Ocepr_0603
Transporters [BR:opr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    Ocepr_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_11 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: ADR36061
UniProt: E4U758
Position
599791..600987
Genome map
AA seq 398 aa AA seqDB search
MKKLWMAALVLLMGMAMAAGQITVWTHFGGPELEFLKDQAQRYEKATGVKVQVVEVPFGD
IKQKFILGAPQGEAADLVVTVPHDWVGEMAAAGVLEPVGKYATQDYLSGLMPVAVDAFSY
GGKLFGLPMNAESVALIYNKDLVQTPPATWDEFLALAKKYTTGDTFGFLYDLGNPYFNYG
WFKAYGAYVFGKNPDGSLNPGDLGLGGEPGYKAGQFIKDLRYKYELIPEGVDYGVADGAF
KDGVLAMILNGPWALGDYKKAGLNFGIAPLPAPPGGDAWGPFVGVQGVVVNAYSKNKIAA
VNFAKALVNPANQVAFNKAGGRIPVSLGALEQLKDDPVVKGFSTTIAMGDPMPNIPAMGK
VWGPWGNALALITQKPDSDVKKIIDDMVAEITKAIKGE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactctggatggcagccctggtgctgctgatgggcatggccatggctgcggga
cagatcaccgtctggacgcacttcggtgggcccgagctcgagttcctgaaggatcaggct
cagcgctacgagaaggcgaccggcgtcaaggtccaggtcgtcgaggtgcccttcggcgac
atcaagcagaagttcatcctgggcgccccccagggcgaggcggccgacctggtggtcacc
gtgccccacgactgggtgggcgagatggcggcggccggggtgctcgagcccgtgggcaag
tacgccacccaggactacctctcggggctgatgccggtggccgtggacgccttcagctac
ggcggcaagctcttcggcctgccgatgaacgccgagtcggtggccctgatctacaacaag
gacctggtccagaccccgccggcgacctgggacgagttcctggccctcgcgaagaagtac
accaccggcgacaccttcggcttcctctacgacctcggcaacccctacttcaactacggt
tggttcaaggcctacggggcctacgtcttcggtaagaatcccgacggcagcctcaacccg
ggcgacctgggcctcggcggcgagccgggctacaaggcgggccagttcatcaaggacctg
cgctacaagtacgagctgatccccgagggcgtggactacggcgtggccgacggcgccttc
aaggacggcgtgctggccatgatcctcaacggcccctgggcgctgggcgactacaagaag
gccgggctcaacttcggcatcgcgccgctgcccgcgcctcccggcggcgacgcctggggt
cccttcgtgggcgtgcagggcgtggtcgtgaacgcctactcgaagaacaagatcgccgcg
gtgaacttcgccaaggcgctcgtcaaccccgccaaccaggtggccttcaacaaggccggc
ggccgcattccggtctcgctcggcgccctcgagcagcttaaggacgatcccgtggtcaag
ggcttctcgaccaccatcgccatgggcgaccccatgcccaacatcccggcgatgggcaag
gtctggggcccctgggggaacgcgctcgcgctcatcacccagaagcccgattcggacgtg
aagaagatcatcgacgacatggtcgccgagatcaccaaggccatcaagggcgagtaa

DBGET integrated database retrieval system