KEGG   Oceanithermus profundus: Ocepr_0606Help
Entry
Ocepr_0606        CDS       T01369                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
opr  Oceanithermus profundus
Pathway
opr00052  Galactose metabolism
opr00500  Starch and sucrose metabolism
opr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Ocepr_0606
   00500 Starch and sucrose metabolism
    Ocepr_0606
Enzymes [BR:opr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Ocepr_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADR36064
UniProt: E4U761
Position
603902..605644
Genome map
AA seq 580 aa AA seqDB search
MNYHDHDPDCIDPLVPELGGEVRLRVRTAARRGQLVYLHHGELVRLELTPVAGGLEARVP
VVEPVLRYAFFLEGRFFGSHGDEGALPRYDRFFHLLTAPGVPDWAAGRVFYQIFPDRFRN
GRPELSPRSGEWKYQGKPIVAKPWGAPPDPAQGAREFYGGDLWGVVEALDYLDDLGVGGL
YLTPIFKSPSSHRYDTEDYHQIDPHLGGRAAFDALVEGLHRRGMKLVLDGVFNHTGDRFF
GFQEALESPHSPWREAFTFLPGGHYAAFFGVPTLPKLNYASELVWRYFVTGPDAVVRYWI
RAGADGWRLDVAQQIGEGATDRGNARVLRAIKEAARAEDPGAYVFGELAFDTVPYLRAHT
LDGAMHYAGFANPLLEWLGGRDWYGHPVRTGAAEVWRALWDHYAALPLGVRQAMYTLIGS
HDVPRPLWRLRGDVEKLKLLFGVLLTFPGAPGIYYGDEIGLDQANPYDEWRGDPLNRGTF
PWEPERWNEDVRGWVRRLVRLRRERVELRRGGLLPLAGPEGALAYRRRYRGRELWVLAAP
EPVRWRLPRARELVAEREVEGELEWRGMLVLEPLEGGGDA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccacgaccacgaccccgactgcatcgaccccctggtgcccgagctggggggc
gaggtgcgccttcgcgtgcgcaccgcggcccgccgcgggcagctcgtctacctgcaccac
ggcgagctggtgcggctcgagctgaccccggtcgccggcgggctggaggcgcgggtgccg
gtggtggagccggtgctgcgctacgccttcttcctggagggccgcttcttcggcagccac
ggcgacgagggcgcgctgccgcgctacgaccgcttcttccacctgcttaccgccccgggc
gtgcccgactgggccgcggggcgggtcttctaccagatctttcccgaccggttccgaaac
ggccggcccgagctaagcccgcgttcgggcgagtggaagtaccagggcaagccgatcgtg
gccaaaccctggggcgcgccgcccgatccggcgcagggcgcgcgcgagttctacggcggc
gacctctggggcgtggtcgaggcgctcgactacctggacgatctgggcgtcggtggcctt
tacctgacgcccatcttcaagagcccttcgagccaccgctacgacaccgaggactaccac
cagatcgacccccacctgggcggccgggcggccttcgacgccctcgtcgaaggcctgcac
cggcgcggcatgaagctggtgctcgacggcgtcttcaaccacaccggcgaccgcttcttc
ggcttccaggaggcgctagagagcccccactcgccctggcgcgaggccttcaccttcctt
ccgggcggccactacgccgccttcttcggggtgccgacgctgcccaagctgaactacgcc
agcgagctggtctggcgctacttcgtcaccggacccgacgcggtggtgcgctactggatc
cgcgccggcgccgacggctggcggctcgacgtggcccagcagatcggcgagggggccacc
gaccggggcaacgcccgggtgctgcgggccatcaaggaggcggcccgggccgaggacccc
ggggcctacgtcttcggcgagctggccttcgacaccgtaccctacttgcgcgcgcacacc
ctcgacggggcgatgcactacgccggcttcgccaatccgctgctcgagtggctgggcggg
cgcgactggtacggccatccggtgcgcaccggcgcggccgaggtctggcgggcgctgtgg
gaccactacgccgccctgccgctgggggtgcgccaggcgatgtacaccctgatcggctcc
cacgacgtgccccggccgttgtggcggttgcggggcgacgtggagaagctgaagctgctc
ttcggggtgctgctgacgttccccggcgcgcccggcatctactacggcgacgagatcggc
ctcgaccaggccaacccgtacgacgaatggcgcggcgacccgctgaaccgcggtaccttc
ccctgggagccggagcgctggaacgaggacgtgcgcggctgggtgcggcggctggtgcgg
ctgcgccgggagcgcgtggagctgcgccgcggggggctcttgccgctcgcggggcccgag
ggggcgctggcctaccggcggcgctaccgcgggcgcgagctgtgggtgctggccgcgccc
gagccggtgcgctggcgcctgccgcgggcgcgcgagctcgttgcggaacgggaagtggaa
ggcgagttggagtggcggggcatgctggtgctcgagccgctggaaggaggaggggatgcg
taa

DBGET integrated database retrieval system