KEGG   Oceanithermus profundus: Ocepr_0623Help
Entry
Ocepr_0623        CDS       T01369                                 

Definition
(GenBank) LSU ribosomal protein L10P
  KO
K02864  large subunit ribosomal protein L10
Organism
opr  Oceanithermus profundus
Pathway
opr03010  Ribosome
Module
opr_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:opr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ocepr_0623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:opr03011]
    Ocepr_0623
Ribosome [BR:opr03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ocepr_0623
  Bacteria
    Ocepr_0623
  Archaea
    Ocepr_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L10
Motif
Other DBs
NCBI-ProteinID: ADR36081
UniProt: E4U7Z1
Position
623478..624005
Genome map
AA seq 175 aa AA seqDB search
MPSERNVQLLGRLKEMLQQTNGSFFLVNYQGLDANEEFQLRRQVTQAGGRIFVAKNTLIR
IAVRDLELPEVDEVLKGPSAVVIYDEPVAVAKALVQFAKENSKEIPQIKAGFLQGQKLAP
EEVKAIAELPTLDELRAELVGVLQAPMSELVGVLEGAQREFVGLLDAYVSKQEAA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagtgaacgcaacgtgcaactgctgggacgcctcaaggagatgctccagcagacg
aacggctcgttcttcctggtgaactaccagggtctcgacgccaacgaagagttccagctg
cggcgccaggtcacccaggccggcggccgcatcttcgtggccaagaacaccctgatccgg
atcgccgtccgcgacctagagctgcccgaggtggacgaggtgctcaagggacccagcgcg
gtggtgatctacgacgagccggtggccgtggccaaggccctggtgcagttcgccaaggag
aactccaaggagatcccgcagatcaaggcgggcttcctgcagggccagaagctggcgccc
gaggaagtcaaggccatcgccgagctgccgacgctcgacgagctgcgggcggaactggtg
ggcgtgctgcaggcgccgatgtcggaactcgtgggcgtgctcgagggcgcgcagcgcgag
ttcgtgggcctgctggacgcgtacgtaagcaaacaagaagcggcgtag

DBGET integrated database retrieval system