KEGG   Oceanithermus profundus: Ocepr_0626Help
Entry
Ocepr_0626        CDS       T01369                                 

Definition
(GenBank) DNA-directed RNA polymerase subunit beta'
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
opr  Oceanithermus profundus
Pathway
opr00230  Purine metabolism
opr00240  Pyrimidine metabolism
opr01100  Metabolic pathways
opr03020  RNA polymerase
Module
opr_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ocepr_0626
   00240 Pyrimidine metabolism
    Ocepr_0626
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    Ocepr_0626
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Ocepr_0626
Transcription machinery [BR:opr03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     Ocepr_0626
DNA repair and recombination proteins [BR:opr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      Ocepr_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 FliMN_C DUF4892
Motif
Other DBs
NCBI-ProteinID: ADR36084
UniProt: E4U7Z4
Position
628022..632608
Genome map
AA seq 1528 aa AA seqDB search
MKRELKKVRIALASPEKIHAWSYGEVEKPETINYRTLKPERDGLFDERIFGPVKDYECAC
GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWYVKDVPSKIGTLLDLTA
GELEQVLYFAKYIVIDPGGAMLEGVPIKRGELLSDEQYRELKFGRQETYAIPLGTDALIK
DGDYVTKGQELAPGVVSKMDGVALFRFPRRISVEYVERERAHLVLPREAWIEADRYEAGE
PIAELADPFVFESEAAGVAEVLEWDEGALVRLRDPESDEVVAVYLVPVGFALKVGHGELV
SAGDPIAAAEPGAVRLPRGVKVTELEAEEEGDLVYLSMTVEWARVQDYRLEPHMHVLVGE
GAEVLKGDKLVGAIDPEEEVHAEADGIVHLHEPASIVVMKARLYPFEDDVEVTTGDRIAP
GDVLADGGKVTSEIYGRVEVDLVRQVVRVIESYDIDARMGAEAVQVLLSELDLDQLEAEL
EEEMLGPSRHKRSRARKRLEIVRAFKASGNRPEWMVLEAVPVLPPDLRPMVQVDGGRFAT
SDLNDLYRRLINRNNRLKKLMSQGAPEMIIRNEKRMLQEAVDALIDNGRRGSPVTNPGSD
RALRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQTGLPKRMALELFKPFL
LRRMEEKGIAANIKQARRMLERHRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQ
PVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSYAQAEARVQMLSAHNLLSPASGEP
IAKPSRDIILGLYYITQLRREKKGAGREFATPVEAIEAYDKGEIALNAPIKIAGEETTVG
RYKYVFASVDEAIVAVQHGLIDLQDVVSIRVGDEVRVTSPGRALFVRMVIEAIKDGDPEA
EVPEELLNYDVAQEKNSLRDLVYRSFLLLGIEKTARLLDVLKAEGFHFSTSSGITIGIDD
VIIPPEKEQYLREADEALDKIENAYKQGLLTDEERRRQIIKLWADVTEKVTEALFKNFEE
KYPFNPLYVMAQSGARGNRTQIRQLGGMRGLMAKPSGEIMEVPVRANFREGLTVLEYFIS
THGARKGGADTALRTADSGYLTRKLVDVAHEIVVREEDCGTTDFMEVPLFQTSATGERSL
RREGEIEQTLYGRTVARDFEAGGRSFAEGQMLSREDVDALVAAARAGELEAVPVYSPLTC
RTEYGVCRKCYGYDLSMAQPVSIGETVGVVAAESIGEPGTQLTMRTFHTGGVATGSDITL
GLPRVIELFEARRPKVKAIIAEIDGEVEVEETDDKLLVRVVSGEFKKEYKIDKAARLTVR
SGDHVTAGTPLTRGAVDPHQLLEAQGPEAVQRYLVSEIQRVYRAQGVKVHDKHIEVIVRQ
MLKYVEVTDPGESKLLEGQVLERWEVERVNEALMEEGKMPASWKPLLMGVTKSALNTRSW
LSAASFQHTTHVLTEAAIWGKKDELIGLKENVILGKLIPAGTGTDFVRRTQVVDERTLER
LKEARKAAEEVVATQVLPGAGAEAGAEG
NT seq 4587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaactcaagaaagtacggatcgccctggccagcccggagaagatccacgcc
tggtcgtacggcgaggtcgagaagccggagacgatcaactaccgcacgctcaagcccgag
cgcgacggcctcttcgacgagcgcatcttcggtccggtcaaggactacgagtgcgcctgc
ggcaagtacaagcgccagcgcttcgagggcaaggtctgcgaacgctgcggcgtcgaggtc
accaagtcgatcgtgcgccgctaccgcatgggccacatcgagctggccaccccggcggcc
cacatctggtacgtcaaggacgtgcccagcaagatcggcaccctgctcgacctgacggcg
ggcgagctggagcaggtgctctacttcgccaagtacatcgtcatcgatcccggcggggcg
atgctcgagggcgtgcccatcaagcgcggcgagctcctcagcgacgagcagtaccgcgag
ctcaagttcggccgtcaggagacctacgccatccccctgggtaccgacgccctgatcaag
gacggcgactacgtgaccaagggccaggagctggccccgggcgtggtcagcaagatggac
ggggtggcgctcttccgcttcccccgccgcatctcggtggagtacgtcgagcgcgagcgc
gcccacctggtgctgccgcgggaggcctggatcgaggccgaccgctacgaggcgggcgag
cccatcgccgaactggccgaccccttcgtcttcgagagcgaggccgcgggcgtggccgag
gtgctcgagtgggacgagggggcgttggtgcgcctgcgcgaccccgagagcgacgaagtg
gtggccgtctacctggtgcccgtgggtttcgccctcaaggtggggcacggtgagctggtg
agcgccggcgaccccatcgccgcggccgagccgggggcggtgcgcctgccccgcggggtc
aaggtgactgagctcgaggccgaggaagaaggcgacctcgtctacctctccatgaccgtg
gaatgggcccgggtgcaggactaccggctcgagccccacatgcacgtcctcgtgggcgag
ggcgccgaggtgctcaagggcgacaagctggtgggcgccatcgaccccgaggaggaggtc
cacgccgaggccgacgggatcgtgcacctgcacgagcccgcctcgatcgtggtgatgaag
gcccgcctctaccccttcgaggacgacgtcgaggtcaccaccggcgaccgcatcgccccg
ggcgacgtgctcgccgacggcggcaaggtaacgagcgagatctacggccgcgtcgaagtg
gacctggtgcgccaggtggtgcgcgtcatcgagagctacgacatcgacgcgcgcatgggc
gccgaggccgtgcaggtgctgctcagcgagctcgacctggaccagctcgaggccgagctg
gaagaggagatgctgggccccagccgccacaagcgcagccgcgcccgcaagcgcctggag
atcgtccgcgccttcaaggcctcgggcaaccgccccgagtggatggtgctggaggcggtg
ccggtgctgccgcccgacctgcgcccgatggtccaggtcgacggcggccgcttcgccacc
agcgacctcaacgacctctaccgccgcctcatcaaccgcaacaaccgcctcaagaagctg
atgagccagggggcgccggagatgatcatccgcaacgagaagcggatgctccaggaggcg
gtggacgccctcatcgacaacggccgccgcggcagccccgtcaccaaccccggttccgac
cgggcgctgcgctcgctcaccgacatcctctcgggcaagcagggccgcttccgccagaac
ctgctgggcaagcgcgtggactactcgggccgctcggtgatcgtcgtggggccgcagctc
aagctgcaccagacgggcctgcccaagcggatggcgctcgagctcttcaagcccttcctg
ctgcgccgcatggaggagaagggcatcgccgccaacatcaagcaggcgcggcggatgctg
gaacgccaccgcgacatcaaggacgaggtctgggacgcgctggaagaggtgatccacggc
aaggtggtcctcctcaaccgcgcccccacgctgcaccgtctcggcatccaggccttccag
ccggtgctcgtcgagggccagtcgatccagctgcacccgctcgtctgcgaggccttcaac
gccgacttcgacggcgaccagatggccgtgcacgtgccgctttcgagctacgcccaggcc
gaggcccgggtgcagatgctgagcgcccacaacctcctcagccccgcctcgggcgagccg
atcgccaagcccagccgcgacatcatcctgggcctctactacatcacccagctgcgtcgg
gagaagaagggcgcgggccgtgagttcgccaccccggtcgaggccatcgaggcctacgac
aagggcgagatcgccctgaacgcccccatcaagatcgccggcgaagagaccaccgtcggc
cgctacaagtacgtcttcgccagcgtagacgaggccatcgtcgccgtgcagcacggcctg
atcgacctgcaagacgtggtcagcatccgcgtgggcgacgaggtccgggtcaccagcccc
ggccgcgccctcttcgtgcgcatggtcatcgaggccatcaaggacggcgaccccgaggcc
gaagtgcccgaggagctgctcaactacgacgtggcgcaggagaagaactcgctgcgcgac
ctcgtctaccgctccttcctgctgctcggcatcgagaagaccgcgcgcctgctcgacgtg
ctcaaggccgagggcttccacttctccacctcctcggggatcacgatcggcatcgacgac
gtgatcatcccgcccgagaaggagcagtacctgcgcgaggccgacgaggccctcgacaag
atcgagaacgcctacaagcagggtctgctcaccgacgaggagcgccgccgccagatcatc
aagctctgggccgacgtgaccgagaaggtgaccgaggcgctcttcaagaacttcgaggag
aagtaccccttcaacccgctctacgtgatggcccagtcgggcgcccgcggtaaccgcacc
cagatccgccagctcggcgggatgcgcggcctcatggccaagccttcgggcgagatcatg
gaggtcccggtgcgggccaacttccgcgaagggctgaccgtgctcgagtacttcatctcc
acgcacggcgcccgcaagggcggggccgacaccgcgctccgcaccgccgactcgggctac
ctgacccgcaagctggtcgacgtggcccacgagatcgtagtgcgcgaggaggactgcggc
accaccgacttcatggaggtgcccctcttccagacctcggccaccggcgagcgcagcctg
cgccgcgagggcgagatcgagcagaccctctacggccgcaccgtcgcccgcgacttcgag
gccggcggccgcagcttcgccgagggccagatgctcagccgcgaggacgtggacgccctc
gtcgccgcggcgcgcgccggcgagctggaggccgtgccggtctacagcccgctcacctgc
cgcaccgagtacggcgtctgccgcaagtgctacggctacgacctctccatggcccagccg
gtctcgatcggcgagaccgtgggcgtggtcgcggccgagtcgatcggcgagccgggcacg
cagctgacgatgcgcaccttccacaccggcggcgtggccaccggctccgacatcaccctg
ggtctgccgcgcgtgatcgagctcttcgaagcgcgccggcccaaggtcaaagcgatcatc
gccgagatcgacggcgaggtcgaggtcgaggagaccgacgacaagctgctggtgcgggtg
gtcagcggtgaattcaagaaggagtacaagatcgacaaggccgcccgccttaccgtgcgt
tcgggcgaccacgtcaccgccggcaccccgctcacccgcggcgcggtggacccgcaccag
ttgctcgaggcccagggccccgaggcggtgcagcgctacctggtgagcgagatccagcgc
gtctaccgcgcccagggcgtgaaggtgcacgacaagcacatcgaggtgatcgtgcgccag
atgctcaagtacgtcgaggtcaccgaccccggcgagtccaagctgctcgaagggcaggtg
ctggagcgctgggaggtggagcgcgtcaacgaagcgctgatggaagagggcaagatgccc
gcgagctggaagccgctcctcatgggcgtgaccaagagcgcgctcaacacccgctcctgg
ctctccgcggccagcttccagcacaccacccacgtgctcaccgaggcggcgatctggggc
aagaaggacgagctcatcggcctcaaggagaacgtcatcctcggcaagctcatccccgcg
ggcacgggcaccgacttcgtgcgccgcacccaggtggtggacgagcgcaccctcgagcgc
ctcaaggaggcccgcaaggccgccgaagaggtggtcgcaacccaggttctgcccggcgcc
ggcgccgaagccggggccgaaggctag

DBGET integrated database retrieval system