KEGG   Oceanithermus profundus: Ocepr_0769Help
Entry
Ocepr_0769        CDS       T01369                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
opr  Oceanithermus profundus
Pathway
opr00790  Folate biosynthesis
opr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ocepr_0769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:opr04147]
    Ocepr_0769
Enzymes [BR:opr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Ocepr_0769
Exosome [BR:opr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ocepr_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ADR36226
UniProt: E4U797
Position
776920..777228
Genome map
AA seq 102 aa AA seqDB search
MVLMEKRWSEEQIRHALEGLEGWRYDDGRIERVFEFATYADGVAFATRIFLLSEKQNHHP
DAVCVLWKKVGVAYTTHDVGGVTERDLKAATMINLLYQRFTD
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcatggagaagcgctggtcggaagaacagattcgccacgccctcgaggggttg
gaagggtggcggtacgacgacgggcggatcgagcgcgtcttcgagttcgccacctacgcc
gacggggtggccttcgccacccgcatcttcctgctttccgagaagcagaaccaccacccc
gacgcggtctgcgtgctctggaaaaaggtaggggtggcctacaccacccacgacgtcgga
ggggtcacggagcgcgacctcaaggccgcgacgatgatcaacctgctctaccagcgcttt
actgactga

DBGET integrated database retrieval system