KEGG   Oceanithermus profundus: Ocepr_1090Help
Entry
Ocepr_1090        CDS       T01369                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
opr  Oceanithermus profundus
Pathway
opr00900  Terpenoid backbone biosynthesis
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ocepr_1090
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Ocepr_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ADR36547
UniProt: E4U7U8
Position
complement(1117400..1118503)
Genome map
AA seq 367 aa AA seqDB search
MSEPLRVVVLGSTGSIGTQTLDVVRWRGWKVVGLAAGRNRALLAEQVRAFRPEVVYAAGG
VPELPPGVRAAASAAEVAAWDADVVVAAIPGLAGLEPVRAAVRAGRRVALANKESMVAAG
PLLQEEARKYGAAFVPVDSEHSALFQALAGERPEDVAELVLTASGGPFREGPEDLSGVTP
EEALRHPRWSMGPKVTIDSATLMNKGLEVLEAHALFGTELERIKVVVHPQSYVHSLVRFV
DGQIKAVLGPTDMRLAIQYALTYPERAPTPRAAEPLPPRLDFEPPDLQRFPALELAYRAG
AQGGLAPTVLNAANEVAVEAFLSGRLGFTGIARVVESVLGKTPPDPLTWENLYAADAWAR
AEAEEQL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacccctgcgcgtcgtcgttctcggctccaccggctccatcggtacccagacc
ctggacgtcgtgcgctggcgtggctggaaggtcgtcggactggccgcgggaaggaaccgt
gcgctgctggccgagcaggtgcgggccttccgccccgaggtcgtctacgccgccggcggc
gtgcccgagctgccgcccggagtgcgcgccgccgcctcggcggccgaggtcgcggcgtgg
gacgccgacgtcgtcgtcgccgccattcccggactcgccgggctcgaacccgtgcgcgcc
gccgtgcgcgccggccgccgcgtggccctggccaacaaggaaagcatggtcgcggcgggt
ccgctgcttcaggaagaggcccgcaagtacggggccgccttcgttcccgtcgactcagag
cactccgcgctgttccaggccctcgcgggcgagcggcccgaggacgtggccgaactggtc
ctcacggcttcgggcggcccgttccgcgaaggaccggaggacctgagcggcgtcaccccc
gaggaggcgctccgccatccgcgctggtcgatgggccccaaggtcaccatcgactcggcc
accctgatgaacaaggggctcgaggtgctcgaggcgcacgccctcttcggaacggagctg
gaacgcatcaaggtcgtcgtccacccccagtcgtacgtgcactcgctggtgcgcttcgtc
gacggccagatcaaggcggtcctggggcccaccgacatgcgcctcgcgatccagtacgcc
ctcacctaccccgaacgcgcccccaccccccgggccgcggagccgttgccgccgcggctc
gacttcgaacccccggacctgcagcgcttccccgccctcgaactggcctaccgcgccggc
gctcagggggggctggcccccaccgtgctcaacgccgccaacgaggtcgcggtcgaggcc
tttctctcgggccggctcggcttcaccggcatcgcccgggtcgtcgagtccgttctaggc
aaaaccccgcccgacccgttaacctgggagaacctctacgcggccgacgcctgggcgcgc
gcagaggcggaggagcagctttga

DBGET integrated database retrieval system