KEGG   Oceanithermus profundus: Ocepr_1363Help
Entry
Ocepr_1363        CDS       T01369                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
opr  Oceanithermus profundus
Pathway
opr00220  Arginine biosynthesis
opr00330  Arginine and proline metabolism
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01130  Biosynthesis of antibiotics
opr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Ocepr_1363
   00330 Arginine and proline metabolism
    Ocepr_1363
Enzymes [BR:opr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Ocepr_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADR36819
UniProt: E4U8Y9
Position
complement(1400609..1401499)
Genome map
AA seq 296 aa AA seqDB search
MKQAVIVGVPMDLGAGRRGVDMGPSAIRYARLHEAIRALDYAVLDRGDLEVPVVETLKKN
GGAPGGLHHLEPIRSTCEALARELSALDDAALPVVLGGDHSISMGSVRGVQRGRTGLIWI
DAHADFNTPETSPSGNIHGMPLAALLGYGDERLVRIGGGEPLEPQDVVLVGVRSVDPGER
ELLQRAGVTVYTMKEIDRMGVPTVAANVVAQLERVERVHVSFDADVLDPTVAPGVGTPVP
GGLTYREAHLLMELLSDAGIVTSLDLVEVNPILDERNRTAEIVVELAASLLGKKIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggccgtcatcgtaggggtgcccatggaccttggcgccggccggcgcggcgtg
gacatggggcccagcgccatccgttacgcgcggttgcacgaagcgattcgcgccctcgac
tacgccgtcctcgatcggggcgacctggaggtgccggtcgtcgaaaccctgaagaagaac
gggggcgcgcccggagggctgcaccacctggaaccgatccgttcgacctgcgaggcgctg
gcccgggagctgtccgccctcgacgacgccgccctgccggtggtgcttgggggcgaccac
tcgatcagcatgggctccgtgcgcggtgtgcagcgcgggcgcacggggctgatctggatc
gacgcccacgccgacttcaacacgcccgagaccagcccttcgggcaacatccacggcatg
ccgctggccgcgctcttgggctacggcgacgagcggctggtgcggatcggcggcggagaa
cccctcgagccgcaggacgtcgtcctcgtcggggtgcgcagcgtcgaccccggcgagcgg
gagctgctgcagcgggccggggtgacggtgtacacgatgaaggagatcgaccgcatgggc
gtccccacggtggcggccaacgtggtggcccagctcgagcgcgtggagcgggtgcacgtt
tccttcgacgccgacgtgctcgaccccacggtggcgcccggcgtgggcacgcccgtgccc
ggggggctgacctaccgcgaggcccacctgttgatggagctcctttccgatgcgggcatc
gtgaccagtctggacctggtggaggtcaacccgatcctcgacgaacggaaccgcacggcc
gagatcgtcgtcgagctggccgcgagccttctggggaagaagatcctctga

DBGET integrated database retrieval system