KEGG   Oceanithermus profundus: Ocepr_1589Help
Entry
Ocepr_1589        CDS       T01369                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
opr  Oceanithermus profundus
Pathway
opr00860  Porphyrin and chlorophyll metabolism
opr01100  Metabolic pathways
opr01110  Biosynthesis of secondary metabolites
opr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ocepr_1589
Enzymes [BR:opr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ocepr_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADR37042
UniProt: E4U9E6
Position
complement(1623765..1624475)
Genome map
AA seq 236 aa AA seqDB search
MEGVVLTRNPEKDRELARRLDAFGVPYASVPLLEHAPGPDFPDLAGALGEAWAWVAVTSP
TAAGFLARAWEAAGRPALRVAALGGGTARALERAGLTPEFTAPEAYGRALAETLPEPGPL
LWPTSSRAGEELGRVLEARGFRVRRLDAYTTRPRPLAPEEVARLEAAAVAAVASPSAVAA
WVRAAAARPPLAAIGRVTAEAARAAGFVCVVWPERPGVAGWAERIRDLYEEKGHLP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggggtcgtcctcacccgcaaccccgagaaggaccgcgagctcgcccgtcgcctc
gacgccttcggggtgccgtacgcgagcgtccccttgctggagcacgcgcccggacccgac
ttccccgacctcgccggtgcgttgggcgaggcctgggcctgggtggccgtgacctcgccc
accgcggccggtttcctggcgcgcgcctgggaggcggcggggcggccggcgctgcgggtg
gcggcgctgggcggaggcacggcccgggcgctcgagcgcgcggggctcacgcccgagttc
accgcccccgaggcctacggccgggcgctggccgagaccctgccggagcccggcccgctg
ctctggcccacctcgagccgggccggggaggagctgggccgcgtcttggaggcccggggc
ttccgggtgcggcggctcgacgcctacaccacccgcccccggccgctcgcgccggaagag
gtcgcgcggctcgaggccgccgccgtcgcggcggtcgcctcgccctcggcggtggcggct
tgggtgcgcgccgccgcggcccgccctccgctggccgcgattgggcgcgtgaccgcggag
gcggcgcgcgccgccggcttcgtctgcgtggtctggccggagcggcccggggtcgcgggc
tgggccgaacgaatccgcgacttgtacgaggaaaagggacacctgccctga

DBGET integrated database retrieval system