KEGG   Ochrobactrum pseudogrignonense: A8A54_03270Help
Entry
A8A54_03270       CDS       T04415                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ops00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A8A54_03270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ops01007]
    A8A54_03270
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ops03016]
    A8A54_03270
   03029 Mitochondrial biogenesis [BR:ops03029]
    A8A54_03270
Enzymes [BR:ops01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     A8A54_03270
Amino acid related enzymes [BR:ops01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   A8A54_03270
Transfer RNA biogenesis [BR:ops03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A8A54_03270
 Prokaryotic type
   Other AARSs
    A8A54_03270
Mitochondrial biogenesis [BR:ops03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A8A54_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ANG95597
UniProt: A0A1A9FKF6
Position
1:684409..686196
Genome map
AA seq 595 aa AA seqDB search
MHRYRSHTCAALRKSDVGSKVRLSGWVHRVRDHGGILFIDIRDHYGLTQVVADPDSPAFK
IAETVRGEWVIRVDGEVKARADEAVNANLPTGDVEIFATEIEVLAAAKELPLPVFGEPDY
PEDIRLKYRFLDLRRETLHKNIMSRTKIIAAMRRRMTEIGFNEFSTPILTASSPEGARDF
LVPSRIHEGKFYALPQAPQQYKQLLMVAGFDRYFQIAPCFRDEDPRADRLPGEFYQLDLE
MSFVTQEEIWETMEPVMRGIFEEFAEGKPVTQQFRRIAYDDAIRTYGSDKPDLRNPIEMQ
AVTEHFAGSGFKVFANMIANDPKVEVWAIPAKTGGSRAFCDRMNSWAQGEGQPGLGYIFW
RKEGDKLEGAGPIAKNIGEERTEALRNQLGLGDGDACFFVAGQPSKFYKFAGDARTRAGE
ELNLVDRDRFELAWIIDFPFYEWDEDNKKLDFAHNPFSMPQGGMEALETQDPLTLKAYQY
DLVCNGFEIASGSIRNQLPDVMVKAFEKVGLSQQDVEERFGGLYRAFQYGAPPHGGMAAG
VDRVIMLLVGAKNLREISLFPMNQQALDLLMNAPSEVSPAQLRDLHIRLAPTQKS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgttatcgcagccatacctgcgcagcccttcgcaaatcggatgttggttcaaaa
gtccgtctgtctggctgggttcatcgcgtccgtgaccatggtggcatcctcttcatcgac
attcgcgatcattatggcctcactcaggttgttgcagatcctgattcgccagcgttcaag
attgccgaaaccgttcgtggtgaatgggtcatccgtgttgatggtgaagttaaagcccgc
gcagatgaagctgtgaatgccaacttgccgaccggcgatgtagaaatcttcgcaaccgag
atcgaagttctggccgccgccaaggaactgccgctgccagtgtttggcgagccggactat
ccggaagacattcgtctcaagtaccgcttcctcgatctgcgccgcgaaacgctgcacaag
aacattatgagccgcacgaagatcattgcagcgatgcgtcgtcgcatgaccgaaatcggc
ttcaatgagttttcgacgccaatcctgacggcctcctcgccggaaggcgcgcgcgacttc
ctcgtgccaagccgtattcatgaaggcaagttctacgcgctgccgcaggctccacagcag
tataagcagcttctgatggttgccggtttcgaccgctacttccagattgcaccttgcttc
cgcgatgaagatccgcgtgcagaccgtctgccgggtgaattctatcagctcgaccttgaa
atgagcttcgtgacccaggaagaaatctgggaaacgatggaaccagtcatgcgcggcatc
tttgaagagtttgccgaaggcaagcctgtcacgcagcagttccgccgcatcgcttatgac
gacgcgatccgcacctatggttcggacaagcctgatctgcgtaacccgattgaaatgcag
gccgtaaccgagcatttcgctggttccggcttcaaggtcttcgcgaacatgatcgccaac
gatccaaaggtcgaagtctgggcgatccctgcaaagaccggtggtagccgcgcattctgt
gatcgcatgaattcatgggcacagggcgaaggtcagccgggtctcggctacatcttctgg
cgcaaggaaggcgacaagcttgaaggcgctggcccgattgccaagaacattggtgaagaa
cgcaccgaagcgctccgcaaccagctgggtctcggcgacggcgatgcctgcttcttcgtg
gcaggtcagccatcgaagttctacaaattcgcaggtgatgcccgtacgcgcgctggtgaa
gagctgaacctcgttgatcgcgaccgtttcgaactggcctggattatcgacttcccgttc
tatgaatgggacgaagacaacaagaagctcgacttcgcgcacaacccgttctcgatgccg
cagggtggcatggaagcactggaaacgcaggacccgctgacgctcaaggcttaccagtac
gatctggtctgcaacggctttgaaatcgcttccggttcgatccgtaaccagctcccggat
gtgatggtcaaggcgtttgaaaaagttggcctcagccagcaggacgtggaagagcgcttc
ggcggtctctatcgtgcattccagtatggcgcgcctccacatggcggcatggctgccggt
gttgatcgcgttatcatgctgctcgttggtgcaaagaacctgcgcgaaatctcgctgttc
ccgatgaaccagcaggcgctcgatcttctgatgaatgcaccttcggaagtgtcgccagcg
cagctgcgcgatcttcatattcgcttagcgccaacgcagaagagctga

DBGET integrated database retrieval system